KEGG   Listeria monocytogenes Finland 1998: LMLG_0531Help
Entry
LMLG_0531         CDS       T01986                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00340  Histidine metabolism
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01230  Biosynthesis of amino acids
Module
lms_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    LMLG_0531
Enzymes [BR:lms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LMLG_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEO38106
Position
complement(599301..600584)
Genome map
AA seq 427 aa AA seqDB search
MKILTGTINELLNEVKAENNTNNSLQVESEVKSIIEKVKKDGDQALFDFTSQFDGVRLTE
LRVQTADIQSASSKVDPAFLVALQQAKANIESFHSKQKQHAFLDNEKDGVIRGQLIRPLE
TVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPAENGINPHVLAAAKLAGVDEIY
QVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADE
NANPAFIASDLLSQAEHDILARAILITTSKKIAEETQNEINKQLENLPRKAIAQKSIETQ
GKIIIAANTQEMFDIMNEIAPEHLEVQLENPMNYLNQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKDAIVLLAKKEGLDAHAKAIQ
IRFEEEN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaaccggaacaataaacgagctattaaacgaagtcaaagcagaaaacaat
accaataattcactccaagtcgaatccgaagtaaaatcgattatcgaaaaagtaaaaaaa
gatggcgaccaagccctgtttgacttcacatcccagtttgacggcgtacggctcaccgaa
ctacgcgtccagaccgctgatatccaaagtgcaagttccaaagtcgaccctgcctttcta
gtcgcactccaacaagcaaaagcaaatatcgaaagtttccacagcaagcaaaaacaacat
gctttccttgataacgaaaaagatggcgtcattcgaggacaattgattcgtccattagaa
actgtcggcgtatatgttcccggtggcacagcagcctatccatcatcggtattaatgaat
gtgttgcctgccaaaattgctggagtaaagcgaatcgtaatgatcacccctcctgccgaa
aacggtattaatcctcacgttttagccgcggctaaactagctggtgtggacgaaatttac
caagttggtggtgcgcatggaatcgcagctcttgctcacggaacagaatccatccctaaa
gtagataaaatcgtcggtcctggaaatatctatgtcgccactgccaaacgtgaagtgttt
ggcttagttgatatcgacatgatagctggtccatccgaaatcgtcgtgctcgcagatgaa
aatgccaatcccgctttcattgcttccgacttactctcccaagcagagcatgatatttta
gctcgtgctatcttaatcactactagtaaaaaaatcgccgaggaaactcagaacgaaatt
aataaacagctagaaaatttacctcgaaaagcgattgctcagaaatccatcgaaacacaa
gggaaaatcattatcgcagcaaatacgcaagaaatgtttgatattatgaacgaaatcgct
cctgaacacttagaagtacaacttgaaaatccaatgaattacctcaatcaaattaaaaat
gccggttcgattttcttaggaagctatgcatcggaacctcttggcgactattttgccgga
ccaaatcacgtcttacctacaagtggtaccgcgaaattcttctctcctctcggcgtggaa
gatttcacgaaacgttctgcctttatttcttacacaaaagaagcactcgcaaaagaaaaa
gatgctattgttttacttgctaaaaaagaaggcctagatgcccatgccaaagccattcaa
attcgtttcgaggaggaaaactaa

DBGET integrated database retrieval system