KEGG   Listeria monocytogenes Finland 1998: LMLG_1155Help
Entry
LMLG_1155         CDS       T01986                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00010  Glycolysis / Gluconeogenesis
lms00071  Fatty acid degradation
lms00350  Tyrosine metabolism
lms00620  Pyruvate metabolism
lms00625  Chloroalkane and chloroalkene degradation
lms00626  Naphthalene degradation
lms00650  Butanoate metabolism
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01120  Microbial metabolism in diverse environments
lms01130  Biosynthesis of antibiotics
lms01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lms00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMLG_1155
   00620 Pyruvate metabolism
    LMLG_1155
   00650 Butanoate metabolism
    LMLG_1155
  Lipid metabolism
   00071 Fatty acid degradation
    LMLG_1155
  Amino acid metabolism
   00350 Tyrosine metabolism
    LMLG_1155
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LMLG_1155
   00626 Naphthalene degradation
    LMLG_1155
Enzymes [BR:lms01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LMLG_1155
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LMLG_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AEO39162
Position
1656066..1658666
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFESYNQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDLQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQRCSSAAAKVVYDAAIAAGAPEHCIQWVE
KPSLEATKQLMNHDKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANNCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVSYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRESVLTGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPKKHALFPRYESFRADEDYAR
ISRIIGFPAATTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVAKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaagttacaaccaagaacaagta
gacaatatcgttcacgcaatggcacttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaactggacgtggattatacgaagataaatgtattaaaaacatcttc
gcgacagaatatatttggaacaacattaaaaacaataaaacagtcggagttattaacgaa
gacttacaaactggtgtgattgaaattgctgaaccagttggcgttgttgccggcgttaca
cctgtaactaacccaacatctactactcttttcaaagcaattatcgcgattaaaacgcgt
aacccaatcatctttgctttccatccaagtgcacaacgttgttcatcagcagcagcgaaa
gttgtatatgatgcagcaattgcagctggagctccagaacattgtattcaatgggtagaa
aaaccttccctagaagcaacaaaacaattaatgaaccatgataaagttgcacttgtactt
gcaactggtggtgctggaatggttaaatcagcatactctactggtaaacctgcactaggt
gttggaccaggtaacgtaccagcttacattgacaaaacagctaaaatcaaacgttctgtt
aatgacatcattctttctaaatcttttgaccaaggtatgatttgtgcttctgaacaagca
gtaatcgtagacaaagaagtggctaaagaagtaaaagcagaaatggaagcaaacaactgc
tacttcgttaaaggcgctgaattcaaaaaattagaaagctatgttatcaaccctgaaaaa
ggaacacttaacccagatgtagttggtaaatcccctgcatggattgcaaaccaagctggc
ttcaaagttccagaagatacaaaaattcttgtagctgaaattaaaggtgttggcgacaaa
tacccactatctcacgaaaaattaagcccagttcttgcatttatcgaagctgctaaccaa
gcagaagcattcgatcgttgtgaagaaatgttagtatatggaggacttggacactccgca
gttattcactctactgataaagaagttcaaaaagcatttggtatccgtatgaaagcttgc
cgtatcattgtaaacgcaccaagcgcacaaggcggtatcggtgacatttataacggcttc
atcccttccctaacacttggttgtggatcttatggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaattttctttgaaaaatattccactcaataccttcaaaaaatg
gaaggcgttgaacgcgtatttatcgtaactgacccaggaatggttcaattcaaatatgtt
gatgttgtaatcgaacacttgaaaaaacgtggcaatgacgtatcttaccaagtatttgct
gacgttgaaccagatccatctgacgtaacagtttataaaggtgcagaactaatgaaagac
ttcaaaccggacacaattatcgctcttggtggtggttccgcaatggatgctgccaaaggt
atgtggttattctatgaacacccagaagcttcattcttcggcttgaaacaaaaattctta
gatattcgtaaacgtactttcaaatatcctaaacttggtggaaaagcaaaattcgtcgca
attccaacaacaagtggtacaggttctgaagtaacaccttttgcggttattacagacaaa
gaaaataacattaaataccctcttgctgactacgaattaactccagacgttgcgattgtc
gatgcacaatatgtaactactgttccagcacacattactgctgatactggtatggacgtt
ttaactcacgcaattgaatcttatgtatccgtaatggcaagcgattatactcgtggatta
tctatccgcgcaatcgaacttgtttttgaaaacttacgtgaatctgttcttactggtgat
ccagatgcgcgcgaaaaaatgcataatgcttctgccctagctggtatggcgtttgcaaat
gcgttcctaggaatcaaccacagcttggcacacaaaattggacctgaattccacattcct
cacggtcgtgccaatgcaatccttatgccacatgttattcgttataacgcacttaaacct
aaaaaacatgcgttattcccaagatatgaaagtttccgtgctgatgaagattatgctcgt
atctctcgtattatcggcttccctgctgcaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagatgttggtatcgacatgagtcttaaaggacaaaat
gttgctaaaaaagatttggatgctgttgtagatactcttgcagatcgcgcattcatggac
caatgtactacagccaaccctaaacaacctcttgtaagtgaactaaaagaaatctacctt
gaagcttacaaaggtgtttga

DBGET integrated database retrieval system