KEGG   Listeria monocytogenes Finland 1998: LMLG_1711Help
Entry
LMLG_1711         CDS       T01986                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lms  Listeria monocytogenes Finland 1998
Pathway
lms00071  Fatty acid degradation
lms00072  Synthesis and degradation of ketone bodies
lms00280  Valine, leucine and isoleucine degradation
lms00310  Lysine degradation
lms00362  Benzoate degradation
lms00380  Tryptophan metabolism
lms00620  Pyruvate metabolism
lms00630  Glyoxylate and dicarboxylate metabolism
lms00640  Propanoate metabolism
lms00650  Butanoate metabolism
lms00900  Terpenoid backbone biosynthesis
lms01100  Metabolic pathways
lms01110  Biosynthesis of secondary metabolites
lms01120  Microbial metabolism in diverse environments
lms01130  Biosynthesis of antibiotics
lms01200  Carbon metabolism
lms01212  Fatty acid metabolism
lms02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMLG_1711
   00630 Glyoxylate and dicarboxylate metabolism
    LMLG_1711
   00640 Propanoate metabolism
    LMLG_1711
   00650 Butanoate metabolism
    LMLG_1711
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMLG_1711
   00072 Synthesis and degradation of ketone bodies
    LMLG_1711
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMLG_1711
   00310 Lysine degradation
    LMLG_1711
   00380 Tryptophan metabolism
    LMLG_1711
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMLG_1711
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMLG_1711
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMLG_1711
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lms04147]
    LMLG_1711
Enzymes [BR:lms01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMLG_1711
Exosome [BR:lms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMLG_1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEO38943
Position
complement(1423999..1425168)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaacctttttgaggaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system