KEGG   Listeria monocytogenes Finland 1998: LMLG_2021Help
Entry
LMLG_2021         CDS       T01986                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lms  Listeria monocytogenes Finland 1998
Brite
KEGG Orthology (KO) [BR:lms00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LMLG_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ferlin_C Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AEO37956
Position
434735..435742
Genome map
AA seq 335 aa AA seqDB search
MDTVILITVIIVIVGLAFDFINGFHDIANAVATSISTRALKPRVAIGIAAVMNFLGAISF
TGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMPSSSSHALIGAIAGASI
ASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLFHDKKLGKMNRRFRFIQI
GTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWVQVSCAASMAIGSSVGGYR
IIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTTQVIDSSIMGVGTANHKKEV
NWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatacggttattttaataacggttattatcgttatagtggggttagcgtttgatttt
ataaatgggtttcatgatattgcgaatgcggttgccacgagcatttcaactagagcttta
aaaccgcgagtagcaattggtattgcggcagttatgaatttcctgggagccatttcgttt
accggagtagctgaatcgctcaccaaaagcattgtagatccattttcgcttaataatggg
gaatttgtcgttttatgcggcttaatagcggcagtgatttggaatttgatgacttggctt
gttggaatgcctagtagttcatcgcatgcgcttatcggtgcgatagctggggcttccatc
gcatcagccagtagttttagcgtgcttaattggtcaggatttacaactattattattgca
ctcattatctcaccaattatcggttttacagtcggttatttgatttattcgctctttaag
catctttttcacgacaaaaagcttgggaaaatgaatcggcgctttcgttttatccaaatt
ggaactgctgcagcccaagcatattcacacggcacaaatgatgcgcaaaaaacgatgggg
attattacgcttgctttagttgcgagtggacttttgaaagagtcagccggtattccattt
tgggtgcaagtaagttgtgcagcatcgatggcgattgggtcatctgttggcggttatcga
atcattaaaacagtaggaacaaaaatcatgaaaatcaccccagttactggtgttgcatct
gatttaagctctctttccgtaatcatgacagctactttgattcatttgccagtcagtacc
actcaagtcattgacagctcgattatgggtgtcggaacagctaatcataaaaaagaagtc
aattggcgtacggggaaaaatatggttgtaacttggtttattacgttaccactagctgga
cttttagcggcagtggtatactggatatcagcagctatttttttataa

DBGET integrated database retrieval system