KEGG   Listeria monocytogenes Finland 1998: LMLG_2243Help
Entry
LMLG_2243         CDS       T01986                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
lms  Listeria monocytogenes Finland 1998
Brite
KEGG Orthology (KO) [BR:lms00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lms03009]
    LMLG_2243
Enzymes [BR:lms01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     LMLG_2243
Ribosome biogenesis [BR:lms03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LMLG_2243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_32 Methyltransf_8 AviRa Methyltransf_12 CheR KR UPRTase zf-TFIIIC
Motif
Other DBs
NCBI-ProteinID: AEO39403
Position
complement(1927666..1928529)
Genome map
AA seq 287 aa AA seqDB search
MEINKRALKENMALLACPICGAAFEFREPQSFVCLEGHGFDIAKPGYVHLLKQAHKTKYD
QALFESRKKVIASGFFEKLIERVTEIIAEKKKEQLVLYDAGCGEGSHLARVVSNLQATGV
NVKAVGLDIAKEGVKQAARDYPGTSWTVADLANCPNQAETADVILNILSPSNYVEFKRLL
KKDGFLLKVVPEANYLRELREFIYVDEKSSYSNESVTSRLAEKLSVEHVERVTYKAPIAK
ELFADFLEMTPLGWHIEADKKNELLENPPEELTVDLQIIIANRAHLL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggagataaataaacgcgctttgaaagaaaatatggcgcttcttgcttgtccaatttgt
ggcgcagcattcgagtttagagagccgcagtcatttgtatgcctagaaggtcatgggttt
gatatcgccaaaccaggttacgtacatttactaaaacaagcgcataaaacaaaatacgat
caagcattattcgaatcccgtaaaaaagtgattgcgagtggcttttttgaaaaattaatc
gaacgagtgacagaaattattgcggagaagaaaaaagaacaacttgttttatatgatgca
ggttgcggggaaggaagtcatttagcgcgagtcgtatcgaatttacaagcgactggtgtt
aatgtcaaagcagttggcttagatatcgccaaagagggagtgaaacaagcggcacgcgac
tatcctggtacttcttggacggtagctgatttagccaattgcccgaatcaagcagagacg
gcggatgtcattttaaatattttatcgccatcgaattacgtggagttcaaacggctttta
aagaaggatggatttttgttaaaagtagtgccagaagcgaattatttacgcgaattacgc
gaatttatttatgttgatgagaaaagtagttattcgaatgagtcggttacatcacggtta
gcagaaaagttaagcgtagaacatgtcgaacgagtcacctacaaagcgccgattgccaaa
gaattatttgcagattttcttgaaatgacgccacttggttggcatattgaagcggataaa
aaaaacgaattactggaaaacccaccagaagaattaaccgttgacttgcaaattattatc
gcgaatagagcacatcttttgtaa

DBGET integrated database retrieval system