KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_00098Help
Entry
LMRG_00098        CDS       T01984                                 

Definition
(GenBank) PiT family inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LMRG_00098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ferlin_C Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AEO05418
UniProt: A0A0H3GDW3
Position
426428..427435
Genome map
AA seq 335 aa AA seqDB search
MDTVILITVIIVIVGLAFDFINGFHDIANAVATSISTRALKPRVAIGIAAVMNFLGAISF
TGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMPSSSSHALIGAIAGASI
ASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLFHDKKLGKMNRRFRFIQI
GTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWVQVSCAASMAIGSSVGGYR
IIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTTQVIDSSIMGVGTANHKKEV
NWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatacggttattttaataacggttattatcgttatagtggggttagcgtttgatttt
ataaatgggtttcatgatattgcgaatgcggttgccacgagcatttcaactagagcttta
aaaccgcgagtagcaattggtattgcggcagttatgaatttcctgggagccatttcgttt
acaggggtagctgaatcgctcaccaaaagcattgtagatccattttcgcttaataatggg
gaatttgtcgttttatgtggcttaatagcggcagtgatttggaatttaatgacttggctt
gttggaatgcctagtagttcatcgcatgcgcttatcggtgcgatagctggggcttccatc
gcatcagccagtagttttagcgtgcttaattggtcaggatttacaactattattattgca
ctcattatctcaccaattatcggttttacagtcggttatttgatttattcgctctttaag
catctttttcacgacaaaaagcttgggaaaatgaatcggcgctttcgttttatccaaatt
ggaactgctgcagcccaagcatattcacacggcacaaatgatgcgcaaaaaacgatgggg
attattacgcttgctttagttgcgagtggacttttgaaagagtcagccggtattccattt
tgggtgcaagtaagttgtgcagcatcgatggcgattgggtcatctgttggcggttatcga
atcattaaaacagtaggaacaaaaatcatgaaaataaccccagttactggtgttgcatct
gatttaagctctctttccgtaatcatgacagctactttgattcatttgccagtcagcact
acgcaagttattgacagctcgattatgggtgtcggaacagctaatcataaaaaagaagtc
aattggcgtacggggaaaaatatggttgtaacttggtttattacgttaccactagctgga
cttttggcagcagtggtatactggatatcagcagctatttttttataa

DBGET integrated database retrieval system