KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_00592Help
Entry
LMRG_00592        CDS       T01984                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
Pathway
lmt00860  Porphyrin and chlorophyll metabolism
lmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMRG_00592
Enzymes [BR:lmt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     LMRG_00592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEO06132
UniProt: A0A0H3GJI4
Position
1138128..1138703
Genome map
AA seq 191 aa AA seqDB search
MQLIFARHGETDWNVAKKYCGQLDVPLNEHGVQQMEHLREKLEGYSFDLVVTSDLMRVKQ
SANILSNAKTVRFPALNEMNFGDFEGYTYQEISTKFPKAWNEYCNNWQTALFPNGESFPI
FYERVVEVLEVEMEKWQQIDTVLLVGHLGVLRVIALFLQKQTIAQYWDVDFKQGCYSLWD
NKSQRFIISNQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacttatttttgcgcgacacggggagacggactggaatgtagcgaaaaaatattgt
ggtcagcttgatgttcctttaaatgaacatggtgttcaacaaatggaacatctccgcgaa
aagctggagggttactcgtttgatttagttgttacgagtgatcttatgcgcgtgaagcag
tcagcaaacattttgagtaatgcaaagacggttcggtttccggctttgaacgaaatgaat
ttcggtgactttgaaggttatacatatcaggaaattagcactaagtttccaaaggcttgg
aatgaatactgtaataattggcaaactgcattatttccaaatggggaaagttttccgata
ttttatgaacgagtggttgaagtgttggaagtggaaatggaaaaatggcagcaaatcgat
acggtattgctcgtaggtcatcttggtgttttgcgagtcattgcgctttttttacaaaaa
caaactatagcacaatattgggatgtcgattttaagcaagggtgttattcactctgggac
aacaaatctcaacgttttattatttccaatcaatag

DBGET integrated database retrieval system