KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_00654Help
Entry
LMRG_00654        CDS       T01984                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
Pathway
lmt00860  Porphyrin and chlorophyll metabolism
lmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMRG_00654
Enzymes [BR:lmt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     LMRG_00654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA MobB GATase DJ-1_PfpI GETHR
Motif
Other DBs
NCBI-ProteinID: AEO06191
UniProt: A0A0H3GC01
Position
1189729..1191264
Genome map
AA seq 511 aa AA seqDB search
MVKQIMIQGTASDAGKSVLVAGLCRLFKNKGKRVVPFKSQNMSLNSFITATGDEMGRAQV
FQAEAAGVFPDVRMNPVLLKPTNDRQSQVIFMGAILDNMDAVTYHDFKQTLIPKIQAVYQ
SLVDENDIIVLEGAGSPAEINLNDRDIVNMGMAKMVDAPVVLVADIDKGGVFASIYGTIM
LLNEEERARIKGVIINKFRGDVALLQPGIDMIEELTNVPIIGVIPYANLQLEEEDSVSLS
GKNYVPDSNALLNIAIICLPRISNFTDFHILEIQPDISVRYIRNIADFGNPDLVIIPGSK
NTLEDMTFLEESGLKNAIQNYAKNAGKVIGICGGYQMLGQKMLDPNQVESKQLEIAGLGL
LDTETIFLDHKRTTQITGVTHSGEAVEGYEIHMGETKRGESTSPFCEIKAVNGNEETHQD
GAISVNKNIIGTYIHGIFDNDVFLGNLFDELLTRKNKSVYPHEIIKLKEHKEQEYDKLAA
LLEENIQMDQLEKIMKGEKICVSTQKPAIKE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagcaaataatgattcaaggtaccgcttctgatgccgggaaaagcgtgctagtg
gccggattatgccgtctgttcaaaaataaaggtaagcgagttgttccatttaaatctcaa
aatatgtcactcaattctttcataacggcgacaggggatgaaatgggacgggcacaagtt
tttcaagcagaagcggctggtgtttttccagatgtccgcatgaatccagtgctccttaaa
ccgaccaatgatcggcaatcgcaagtgatttttatgggtgcgattttagataatatggac
gctgtgacgtaccatgatttcaaacaaacacttattccgaaaatccaagcagtttaccag
agtttagtggatgaaaatgatattattgtactagaaggtgccggaagcccagccgaaatc
aatttgaacgaccgtgatatcgtgaatatgggcatggcaaaaatggtcgatgcaccagtt
gtcctagttgctgatattgataaaggtggcgtatttgcttcgatttatggcaccattatg
ctgttaaatgaagaagagcgggctcggatcaaaggtgttattatcaataaattccgcggc
gatgtagctcttttacaacccggaattgatatgattgaggaactcacaaacgtcccgatt
atcggtgtgattccttatgccaatttacaactggaagaagaggatagtgtttcactaagt
gggaaaaattacgtgccagatagtaacgcactacttaatatcgcgataatctgtttaccg
cggatttctaatttcacagattttcatattctggaaatccagcccgacataagtgtacgc
tacatccgtaatatagctgattttggaaacccagatttagtcattattcctggaagtaaa
aatacactagaagatatgactttcctcgaagaatctggacttaaaaatgccattcaaaac
tatgctaaaaatgccgggaaagtaatcgggatttgtggtggctaccaaatgctcggtcaa
aaaatgctcgatccgaatcaagtggagagtaaacaattagaaatagccggacttggtttg
ctagataccgagacgatttttctcgaccacaagcgcactactcaaattacaggtgtgacg
cattcaggtgaagctgttgaaggttacgaaatccatatgggtgagacgaagcgcggcgag
agcactagtccattttgtgaaattaaagcggtgaacggaaacgaagaaacccaccaagat
ggcgctatctctgtcaacaaaaatatcatcggtacatatattcatggtattttcgacaat
gatgttttcttaggaaatctatttgacgaactactaacgcgcaaaaacaaatccgtttat
ccacatgaaatcattaaactaaaagaacacaaagaacaagaatacgacaaattagcggct
cttttagaagaaaatatccaaatggaccaactagaaaaaatcatgaaaggagaaaaaata
tgcgtatctacacaaaaaccggcgataaaggaatga

DBGET integrated database retrieval system