KEGG   Listeria monocytogenes 10403S (serotype 1/2a): LMRG_01185Help
Entry
LMRG_01185        CDS       T01984                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine-D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lmt  Listeria monocytogenes 10403S (serotype 1/2a)
Pathway
lmt00471  D-Glutamine and D-glutamate metabolism
lmt00550  Peptidoglycan biosynthesis
lmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LMRG_01185
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMRG_01185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lmt01011]
    LMRG_01185
Enzymes [BR:lmt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     LMRG_01185
Peptidoglycan biosynthesis and degradation proteins [BR:lmt01011]
 Precursor biosynthesis
  Amino acid ligase
   LMRG_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AEO07017
UniProt: A0A0H3GHS6
Position
complement(2073814..2075181)
Genome map
AA seq 455 aa AA seqDB search
MKKIEMYHHKKVLVLGLARSGVSAATIMHKLGAFVTVNDQKPFSENPEAQGLLEQGIKVI
CGSHPIELLDEGFELVIKNPGIPYNNPMIEKALKLKIPVITEVELAYQISEAPIVGITGT
NGKTTTTTIIHHMLNAHKENSSLLAGNIGFPASAVAENATSDQYISMELSSFQLMGVETF
KPHISVITNIYEAHLDYHTDRSEYVQAKWHIQKNQTADDFLVINWDQEELKNLTKQTKAQ
VIPFSTTQRLGQGSYVQNGNIMFNDEVIGERDNILLPGEHNLENVLASVAVAKTLGVTNE
EIMHVLETFKGVEHRTQFVVEWQGRKFYNDSKATNILATQSALKGFKNPVVLLAGGLDRG
NSFDELLPFFKNVKTLIVFGETADKIGRVGKIAGIEVHYVDNVEAAVPVAYRESAPGDII
LLSPACASWDQYRTFEVRGNAYMDAIGELIEEVEK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgaaatgtaccatcacaaaaaagtacttgtcttgggtcttgcaagaagt
ggtgttagcgcggcaacaattatgcataaactgggagcatttgtaactgttaatgatcaa
aaaccttttagcgagaatccagaagcgcaaggtttacttgagcaaggtattaaagttatt
tgcggttcgcacccaattgaacttttggatgagggatttgagcttgttataaaaaacccc
ggaattccgtacaataacccaatgattgaaaaagcgttaaaacttaaaattccagtcatt
acggaagtggaattagcttaccaaatttctgaggcaccgattgttggaatcacaggaaca
aatggtaaaacaacgacaacaacgattattcaccatatgttaaatgcacataaagaaaat
agttctttactagcagggaacattggttttccagcatccgctgttgctgaaaatgcaaca
agtgatcaatatatttcgatggaactatcttcgttccaattaatgggcgtagaaacgttt
aaaccacatatttccgttattacgaatatttatgaggcacatttagactaccatacagac
cgtagcgaatacgtccaagcaaaatggcacatccaaaaaaatcaaacagcggatgatttc
ttagtaattaactgggatcaagaagagcttaaaaatttaacaaaacaaacaaaagcgcaa
gttattcctttttcaacaacgcaacgtcttggtcaaggaagctacgtgcaaaatggcaat
attatgttcaacgacgaagtgattggggagcgtgacaatattttacttcctggagaacat
aacttagaaaacgtacttgcttccgtagcagtagcaaagacattaggtgttacaaacgaa
gaaatcatgcacgtattagaaacatttaaaggtgtagagcaccggacacaatttgttgta
gaatggcaaggtcgtaaattctataacgattcaaaagcaacgaatatccttgcaactcaa
agtgcattaaaagggtttaaaaatccagttgtgttactcgctggtggtttggaccgtggt
aattcatttgacgaattactaccatttttcaaaaatgtaaaaacgttaatcgtctttggc
gaaacagcagataaaattggtcgtgtcgggaaaatcgctggtattgaagtacattacgtg
gataatgtcgaagcggcagttcctgttgcttatcgcgaatcagcgccaggagatattatc
ttactttcaccagcatgtgcgagttgggatcaataccggacatttgaagttcgcgggaat
gcctacatggatgcaatcggtgaactaatagaagaggtggaaaaatga

DBGET integrated database retrieval system