KEGG   Listeria monocytogenes 10403S: LMRG_01791Help
Entry
LMRG_01791        CDS       T01984                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
lmt00010  Glycolysis / Gluconeogenesis
lmt00051  Fructose and mannose metabolism
lmt00562  Inositol phosphate metabolism
lmt01100  Metabolic pathways
lmt01110  Biosynthesis of secondary metabolites
lmt01120  Microbial metabolism in diverse environments
lmt01130  Biosynthesis of antibiotics
lmt01200  Carbon metabolism
lmt01230  Biosynthesis of amino acids
Module
lmt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMRG_01791
   00051 Fructose and mannose metabolism
    LMRG_01791
   00562 Inositol phosphate metabolism
    LMRG_01791
Enzymes [BR:lmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMRG_01791
Exosome [BR:lmt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMRG_01791
  Exosomal proteins of bladder cancer cells
   LMRG_01791
  Exosomal proteins of melanoma cells
   LMRG_01791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEO07433
UniProt: A0A0H3GIY7
Position
complement(2483668..2484435)
Genome map
AA seq 255 aa AA seqDB search
MFIQMRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEG
TNLRVSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAI
FKHGMTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGK
SSTSADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGA
SLEPASFLALLEAVK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtttatccaaatgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgct
gcaaaagcaggacaatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgtt
gaatcagtagttgctgcaccggctctatttttacaagaattagttcgtcttactgaagga
actaatcttcgtgtatctgcacaaaactgttattttgaagacgaaggtgctttcactggc
gaaattagcccgtttgcacttgctgacttaggcgtttcttatgttattatcggacactct
gaacgtcgtgagtacttccacgaaacagacgaagatattaacaaaaaagcacatgcaatc
ttcaaacacggcatgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagct
ggtcaaacagatacttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaa
gaacaagtaatcaaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaa
tcttctacaagtgctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgac
gctgtatctcaaaaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacct
gaaaacattgctgattatcttgcagagtccgacattgacggcgctcttgtaggtggagca
agcttagaaccagcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system