KEGG   Listeria monocytogenes 10403S: LMRG_02755Help
Entry
LMRG_02755        CDS       T01984                                 

Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmt  Listeria monocytogenes 10403S
Pathway
lmt00900  Terpenoid backbone biosynthesis
lmt01100  Metabolic pathways
lmt01110  Biosynthesis of secondary metabolites
lmt01130  Biosynthesis of antibiotics
Module
lmt_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMRG_02755
Enzymes [BR:lmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LMRG_02755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEO05201
UniProt: A0A0H3G8M7
Position
188448..189329
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggatggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaagcgcactttatt
ccagaagatcgtcgcaatttaatttatcaagcggccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcatattcctgtttctgcgggacttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcagaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactggacgcggggagaaaatttctgcgttacctaat
attcctggttgttggattgtacttgctaagccgagcattagcgtgtcaacacccactatc
tataaagaacttcaagtagacaatgtagaacacccagacacacaaaaaatgattgaatcc
atcaaaaatggtgatttagacgggatttttgcggctacagggaatgtgctagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggctctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaattattaa

DBGET integrated database retrieval system