KEGG   Lactobacillus mucosae: LBLM1_01725Help
Entry
LBLM1_01725       CDS       T03814                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00970  Aminoacyl-tRNA biosynthesis
lmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBLM1_01725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lmu03029]
    LBLM1_01725
Enzymes [BR:lmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LBLM1_01725
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LBLM1_01725
Mitochondrial biogenesis [BR:lmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LBLM1_01725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AJT49940
UniProt: A0A0D4CJ40
Position
348949..350373
Genome map
AA seq 474 aa AA seqDB search
MNFETTIGLEVHVELKTHSKIYSPTPVEFGDEPNANTNVIDWAYPGTLPTLNKGVVRDGI
MAGLALHAQISKHMHFDRKNYFYPDNPKAYQVTQSETPIAHDGWIEIEVNGKKKKIGIKE
MHIEEDAGKNTHTSNYSYVDLNRQGTPLIEIVSKPDIASPEEAVAYLEALRQRIQFTGIS
DVKMEEGSMRVDTNISIRPIGSDKYGTKTEMKNINSFNFVKKALNFEQQRHEKVIMAGGT
IAQETRRFDEATGETISMRTKEGSDDYRYFPEPDIPPLEVSDEWIQEIQDAMPEMPGERR
AHYTNDLGLSEYDAMVLTQTKEMSDFFEATIALGADPKKAANYLMNDVNSYLNDKQVDLQ
DTKLTPANLAGMIKLIDDGTISSKMAKKVFKGILDGQEPAAYAEKNGLVQLSDPAKLQPI
VDEVLANNEQSIEDYKNGKDRAVGFLVGQIMKQTRGKANPGVVNKLLMKALNEK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacgaccattgggcttgaagtccacgtggaattgaagacccactctaaa
atctacagtccaacgccagtagaatttggtgacgagcccaacgccaacaccaacgttatc
gactgggcctacccaggtacgctgccaacgttgaacaaaggcgtcgtgcgggatgggatt
atggctggtctggcactgcacgcccaaatctcaaagcacatgcactttgaccggaagaac
tacttctatcctgacaaccctaaggcctaccaggtaacccaatccgaaacgccaatcgca
catgatggctggattgaaattgaggttaatggcaagaagaaaaaaatcgggatcaaggaa
atgcacattgaagaagatgccggcaagaacacccacacgagcaactactcttacgtggac
ttgaaccggcagggcacgcctttgatcgaaatcgtctccaagccagacattgcctcgcca
gaagaagcggtggcctacttggaagctttgcggcagcggattcagtttactgggatctct
gacgttaagatggaagaaggctcgatgcgggtcgacaccaacatctcgattcgtccaatc
ggctccgacaagtatggtaccaagacggaaatgaagaacatcaacagtttcaatttcgtc
aagaaggcactgaactttgaacagcagcggcatgaaaaggtcatcatggctggtggcacg
attgcccaggaaacgcggcgctttgatgaggcaaccggcgaaacgatctcaatgcggacc
aaggaaggaagcgacgactatcgttacttcccagaacctgatattccacctctggaagtc
agcgatgaatggatccaagaaattcaagatgccatgccagaaatgcctggtgaacggcgc
gctcactacaccaacgatctgggcttgagcgaatacgacgccatggtattaacgcagacc
aaggaaatgtctgacttctttgaggctacgattgccttaggagctgatccaaagaaagct
gccaactacctgatgaacgacgtcaacagctacttaaacgacaagcaggttgatctgcag
gataccaagctgacgccggccaacctggcagggatgatcaagctgatcgatgacggcacg
atttcttctaagatggccaagaaagtctttaaaggaattctggatggtcaagaaccagct
gcctacgcggaaaagaatggtctggtacagctttccgacccagccaagctgcagccaatc
gttgatgaagttttggccaacaacgaacaatccatcgaagactacaagaacggtaaggac
cgggcagtaggcttcctggttggtcaaatcatgaagcagacgcgtggtaaggccaaccct
ggtgtggtcaacaagctgttgatgaaggccttgaacgaaaagtaa

DBGET integrated database retrieval system