KEGG   Lactobacillus mucosae: LBLM1_06560Help
Entry
LBLM1_06560       CDS       T03814                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
lmu  Lactobacillus mucosae
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lmu03009]
    LBLM1_06560
Enzymes [BR:lmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LBLM1_06560
Ribosome biogenesis [BR:lmu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LBLM1_06560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Ub-Mut7C S4_2 TGS
Motif
Other DBs
NCBI-ProteinID: AJT50704
UniProt: A0A0D4CKW8
Position
complement(1419056..1419976)
Genome map
AA seq 306 aa AA seqDB search
MNSERQIKIDADLTGRIDKVLGHFLSDVSRSQLQKWIEDGHVTVNGQSVKTKYKLQVGDM
VRIIPEEPQTIDLEPENIPLDIVYEDDDVIVVNKPAGMVVHPAPGHPSHTLVNALLYHSP
LSTINGEFRPGIVHRIDKDTSGLLMVAKNDLAHRSLAAQLKSKTNQREYVALVHGVIKEE
QGTIDAPLGRSKKDRKKQAVVLDGRHAVTHFKVLKRYQHYTLVKCRLETGRTHQIRVHMA
YIGHPLAGDPLYGPRKTLAGPGQYLHAGLLGFRHPRSGQEMTFTAPLPDYFTKMLEHLDK
TDRRDE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaactcagaacgccaaatcaagattgatgccgatctgaccggccgcattgacaaggtt
ttgggccattttctaagtgatgtttcccgctcgcagctgcagaaatggattgaggatggc
cacgttaccgttaatgggcagtccgttaaaaccaagtacaagcttcaagtgggcgatatg
gtgcgcatcatacccgaagaaccgcaaaccattgatttggaaccagaaaacattcccctg
gatatcgtttatgaggatgatgatgtgatcgtcgtcaataaaccggccggaatggtagtg
catcccgcgcctgggcatcccagtcatacgctggtcaacgcactgttgtatcattcgccg
ctgtcgacgatcaatggtgagtttcggccaggaatcgtccaccgcatcgataaggatacc
tcgggcctgttgatggtggccaaaaatgatctggcacaccgcagtctggccgcgcagctg
aagtccaagaccaaccagcgcgagtacgtcgccttggtgcatggcgtgatcaaagaggag
cagggaacgattgatgcgccgctgggtcgttccaaaaaagatcgcaagaaacaggcagtc
gtcttggatggccgtcatgccgtaacgcattttaaggtactgaagcgttatcagcactat
acgctggtcaaatgtcggctggagactgggcgaacgcatcagattcgcgttcatatggcc
tatatcgggcatcccttggctggcgatccactgtatgggccacgcaaaaccctggctgga
ccgggacagtatctgcatgctggtctgttgggctttcgacacccccgcagcggtcaagag
atgacgtttaccgcgccgctgccggactactttaccaagatgcttgaacatttggacaaa
accgaccgccgtgatgaatag

DBGET integrated database retrieval system