KEGG   Lactobacillus mucosae: LBLM1_07370Help
Entry
LBLM1_07370       CDS       T03814                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00071  Fatty acid degradation
lmu00072  Synthesis and degradation of ketone bodies
lmu00280  Valine, leucine and isoleucine degradation
lmu00310  Lysine degradation
lmu00362  Benzoate degradation
lmu00380  Tryptophan metabolism
lmu00620  Pyruvate metabolism
lmu00630  Glyoxylate and dicarboxylate metabolism
lmu00640  Propanoate metabolism
lmu00650  Butanoate metabolism
lmu00900  Terpenoid backbone biosynthesis
lmu01100  Metabolic pathways
lmu01110  Biosynthesis of secondary metabolites
lmu01120  Microbial metabolism in diverse environments
lmu01130  Biosynthesis of antibiotics
lmu01200  Carbon metabolism
lmu01212  Fatty acid metabolism
lmu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBLM1_07370
   00630 Glyoxylate and dicarboxylate metabolism
    LBLM1_07370
   00640 Propanoate metabolism
    LBLM1_07370
   00650 Butanoate metabolism
    LBLM1_07370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBLM1_07370
   00072 Synthesis and degradation of ketone bodies
    LBLM1_07370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBLM1_07370
   00310 Lysine degradation
    LBLM1_07370
   00380 Tryptophan metabolism
    LBLM1_07370
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBLM1_07370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBLM1_07370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBLM1_07370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmu04147]
    LBLM1_07370
Enzymes [BR:lmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBLM1_07370
Exosome [BR:lmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBLM1_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: AJT50836
UniProt: A0A0D4CLS0
Position
complement(1606655..1607833)
Genome map
AA seq 392 aa AA seqDB search
MEKTYIVAARRTPIGKFGKSLAGVSAVELGATAIAAVVKDSGVTKEAVDQVLMGNVIQAG
AGQNPARQAAIKAGLDYATPAITINDVCGSGLSSVSLAAGLIQSNQARIVIAGGMESMSR
APYILNQARGGYRFGDGQLIDALQKDALIDVENGYPMGITAENVAELDQISRQAQDEFAL
RSHQKAVAAQKDHAFDREIVPVEVQTRKGTMIVKDDEAPRADTSIEALQKLKPSFASEGT
VTAGNASGLNDGAAAVMLASESAVKEYGLQPLAEWQATTLVGIDPAYMGLGPAYAIEKLF
NETGISREDVDLYEINEAFASQSVACLRRLKLDERRVNPRGGALALGHPVGCSGARILVT
LIHEMRDLDARTGIASLCIGGGMGVACLVEKA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacatatatcgttgctgctcggcgaacgccaatcggcaaatttggcaagtct
ttggctggcgtttctgccgtcgagcttggtgcaactgcaattgccgccgtcgtcaaagac
agcggcgtaaccaaagaggccgttgatcaggttttaatgggcaacgtgattcaagccggt
gctggccagaatccagctcgtcaggccgcaatcaaggcaggcctagactatgccacgcca
gcaattacgattaatgacgtctgcggctcaggtctgtccagtgtcagtctggcggccggt
ctgattcaatcaaatcaggcccgcattgtgattgctggtgggatggaaagcatgtcgcga
gcaccgtatatcttaaatcaggctcgtggcggctatcgttttggtgatggtcagctgatt
gacgccttgcaaaaagatgccttgattgatgtcgaaaacggctatccaatgggaattacc
gcggaaaacgtggctgaacttgatcaaatcagtcgtcaggctcaagatgaatttgccttg
cgcagtcatcaaaaagcagtggcggcacaaaaagatcatgcctttgatcgcgaaatcgtc
ccagtcgaggttcagactcgcaaaggtacgatgatcgttaaagatgatgaggcaccgcgc
gcggacacctcaattgaagcattgcagaaattaaagccgtcttttgccagtgagggaacg
gttacagctgggaatgcctcgggacttaacgatggggcggcggccgtcatgctggcttct
gaatcggcagtcaaggaatatgggctgcagccgttagcagagtggcaggcgacaaccctg
gtcggtattgatccggcatacatgggattgggaccggcctatgcaattgaaaaactgttc
aacgagacggggatcagtcgtgaggatgttgatctgtatgaaatcaacgaagcctttgcc
tcacaatcggttgcctgcctgcgccgactcaagctggatgaacggcgcgtcaacccgcgt
ggcggtgcactggcgctgggtcatccggtgggctgctcgggagcgcggatcttggtaacg
ctgatccatgaaatgcgggatcttgatgcacggaccgggattgccagtctgtgtattggc
ggcggcatgggcgtggcctgtttggttgaaaaggcgtaa

DBGET integrated database retrieval system