KEGG   Lactobacillus mucosae: LBLM1_08180Help
Entry
LBLM1_08180       CDS       T03814                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00430  Taurine and hypotaurine metabolism
lmu00620  Pyruvate metabolism
lmu00640  Propanoate metabolism
lmu00680  Methane metabolism
lmu01100  Metabolic pathways
lmu01120  Microbial metabolism in diverse environments
lmu01200  Carbon metabolism
Module
lmu_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBLM1_08180
   00640 Propanoate metabolism
    LBLM1_08180
  09102 Energy metabolism
   00680 Methane metabolism
    LBLM1_08180
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LBLM1_08180
Enzymes [BR:lmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LBLM1_08180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AJT50940
UniProt: A0A0D4CLY0
Position
complement(1745374..1746573)
Genome map
AA seq 399 aa AA seqDB search
MSKTIAVNAGSSTVKFKLFDMPSEEVVAEGQIERIGLEVGHAEIKYGDGQKLKEDKPFAD
HEAAVQYLLKQLLDLKIVASYDEITAVGHRIVAGGEYFKDSVVIDEDVMNKIDALAEYAP
LHDPAELQGIKAFKEVLPDAFAVAVFDTAFHANMPKMNALYSVPYEWYEKYGARKYGAHG
TSHRYVAARAAEMLGRPLEELKLITCHIGAGASITAIKGGKSFDTSMGFSPLAGVTMATR
SGDVDPSLVAFVQKKLGVSSDEMVDMLNHKSGLLGISGVSSDMRDVEKAKNEGNERAQLA
WDIYVNRIVRYIGAYIAELGGADAIVFTAGVGENSITVRQAVADKLGYFGIAIDPEKNNI
RGVERDLSTDDAKIKTLLIPTNEELMIVHDIERLKKASK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacgattgctgttaatgccggcagttcgaccgtcaagttcaagctgtttgac
atgccaagcgaagaagtagtagcagaaggtcagattgaacgtatcggtctggaagttggc
catgccgaaatcaagtatggtgacggtcaaaagctgaaagaagataagccatttgctgac
cacgaagctgcagttcaatatctgctcaagcagctgctggatttgaagatcgttgccagc
tatgatgaaattacggctgttggtcaccggattgttgctggtggtgaatactttaaggat
tcggttgtcatcgatgaagacgttatgaataagatcgatgcgctggctgaatatgcacca
ttgcatgacccagctgaattacaaggtattaaggcttttaaggaagtcttgccggatgca
tttgcagttgccgtttttgacactgcttttcatgccaatatgccaaaaatgaatgccctt
tatagtgttccttatgaatggtacgagaagtacggtgcccgcaagtatggtgctcatggt
accagtcaccgttacgtagcggcccgggcagctgaaatgcttggtcgaccattggaagaa
ctaaagctgattacctgccacattggtgctggggcttcgattactgctattaagggtggc
aagtcctttgacacttcgatgggcttttcgccattagccggggttacgatggccactcgc
tctggggatgttgatccatcgctggttgctttcgtccaaaagaagctgggcgtttctagc
gatgaaatggttgacatgcttaaccacaaatccggtctgctgggaatttctggagtttcc
agcgacatgcgcgatgttgaaaaggccaaaaacgaaggcaacgagcgcgcacagttggct
tgggatatctatgtcaaccggatcgttcgctacatcggcgcctacattgctgaactgggt
ggagcagatgccattgtctttactgcgggcgttggtgaaaacagcatcaccgttcgtcag
gccgtagctgacaagctgggctactttggtattgcaattgacccagaaaagaacaacatt
cgtggcgtagagcgtgatctgtcgactgatgatgctaagattaagacgctgctgattcca
actaacgaagaattaatgatcgttcatgatatcgaacgacttaaaaaagccagcaagtag

DBGET integrated database retrieval system