KEGG   Lactobacillus mucosae: LBLM1_09605Help
Entry
LBLM1_09605       CDS       T03814                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
lmu  Lactobacillus mucosae
Pathway
lmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBLM1_09605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lmu01007]
    LBLM1_09605
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lmu03016]
    LBLM1_09605
Enzymes [BR:lmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     LBLM1_09605
Amino acid related enzymes [BR:lmu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   LBLM1_09605
Transfer RNA biogenesis [BR:lmu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LBLM1_09605
 Prokaryotic Type
    LBLM1_09605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f tRNA-synt_1 VPS28 tRNA-synt_1d tRNA-synt_1c BLYB
Motif
Other DBs
NCBI-ProteinID: AJT51192
UniProt: A0A0D4CM09
Position
complement(2048773..2050185)
Genome map
AA seq 470 aa AA seqDB search
MLTIYNTLTRKKEEFKPLHPGVVNMYVCGPTVYNYIHIGNARSAIAFDTVRRYLEFKGYQ
VNYVSNFTDVDDKMIKAAAEQGITVPQLADKFIKAFMEDTAALNIEPATKRPRATESIPE
IIDFIKVLIEKDYAYVKDGNVYYRTRKFKHYGELSGQSIDDLETGASEHITAEEIQQKED
PLDFALWKAAKPGEINWDSPWGQGRPGWHIECSVMSTRYLGKTIDIHAGGQDLQFPHHEN
EIAQSEAETGQQFVRYWMHNGFVTIGKDNEKMSKSLHNFITVHDIIKHVDPQVLRFFMAT
TQYRRPIQYSEANLQDAQNNLEHIRNTYDNLTYRQRDAQNGNDDEVAQRVAAFTQQFITA
MDDDINVQNGIATVYELVKYANVYAQKPVVKAEALKTLKQELEALLGIFGVRLETSNCEI
DDQAIKDLISKRNQARAAKNFALSDQIRDELKAQGIILEDTPQGTRYRKE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgttgactatttataatacgcttacccgtaaaaaagaagaatttaagcctttgcaccct
ggagttgttaacatgtacgtctgtggtcccacggtctacaactacatccatatcggcaac
gcgcgcagtgccattgcctttgataccgtacgtcgctatttggagttcaaaggctatcag
gtcaattacgtctccaactttaccgatgttgacgacaaaatgatcaaggcagctgctgaa
caggggattacggttcctcagttggccgacaagtttatcaaggcctttatggaagatacg
gccgccttaaatatagaaccagctaccaagcgaccacgcgcgacagaaagtattcctgaa
atcattgactttatcaaggtcctgattgaaaaagactatgcttatgtcaaagatggcaac
gtttattatcggacgcgcaagtttaagcattatggcgagctttccggacagtcgatcgat
gatttggaaaccggcgccagtgagcatattacagctgaagagattcagcaaaaagaggat
cctttagattttgcgctttggaaagctgccaaaccaggtgagatcaactgggattcgcca
tgggggcaaggacggcctggctggcacattgaatgctcggttatgtcaacgcgctaccta
ggcaaaacgattgatattcatgcgggtggtcaggatctgcagtttccgcaccatgaaaat
gagattgcgcaaagcgaggcagagactggtcagcagttcgtccgctattggatgcacaat
ggctttgtcacgattggcaaggacaatgaaaaaatgagcaagtcactgcataacttcatt
acggtgcatgacatcatcaagcatgttgatccgcaggtgctgcgcttctttatggcaacc
actcagtatcggcggccgattcaatatagcgaggccaatctgcaggatgcacaaaacaat
ctggaacatatccgcaacacctatgacaacctgacctatcgccagcgtgatgctcagaat
ggcaatgacgatgaagttgctcagcgagtagcggcatttacgcagcagttcattacggca
atggatgatgacattaacgtccaaaacgggattgccacggtctatgagctggtcaaatat
gccaacgtctatgcccaaaagccagtcgttaaggctgaggcgctcaagacgcttaaacag
gagctggaagcgctgctggggatttttggcgtacgtttggaaacgtctaattgtgaaatt
gatgatcaagccattaaagatctgatcagcaagcgtaatcaggcacgggctgctaagaac
tttgccttaagcgatcagattcgcgatgagttaaaggcgcaggggattattctggaagat
accccgcaaggaacgcgctacagaaaggaataa

DBGET integrated database retrieval system