KEGG   Listeria monocytogenes CFSAN006122: Y193_04980Help
Entry
Y193_04980        CDS       T03478                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lmv  Listeria monocytogenes CFSAN006122
Pathway
lmv00520  Amino sugar and nucleotide sugar metabolism
lmv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Y193_04980 (nagA)
Enzymes [BR:lmv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Y193_04980 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AHY97690
UniProt: A0A3A7N225
Position
2185296..2186429
Genome map
AA seq 377 aa AA seqDB search
MAVIKNVKIYKENELIDAAVITEGNLIKEVCSTTPEKYSDEPTFDGNGQLLIPGMIDVHI
HGANNYDMMDGSTESIQAVSMACAETGCTSFLVTSVSSSFEDLIQMIKQTKKVIGKEKGA
KIAGIHLEGPYLNIEKKGMQNPAYLRHPDLKEMKKIFDEADGLIKMVTIAPELPRGIELI
DFLKKRGVVVAIAHSNATYEEAQNAFEQGATHITHCFNAMPAIHHRAPGLVTAALENDSV
SVQTIVDGVHLHPGIVRLIHKIKGPDKMVLTTDALQAMGVGDGEYIFGGHQVTVKEGIAR
LKDGTLASSTVTMNKSLKLSNEFGIHLQDAIQMAASTPADILGMNNFGRIEKGYVADLVL
LDKNFEVLTTWIDGEIY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccgttatcaaaaatgtgaaaatttacaaagaaaatgaattaattgatgcagcagtt
attacagaaggaaatttgataaaagaagtttgctcaactactcctgaaaagtattcagat
gagccaacttttgatggaaatggacagttgctaattcccggaatgatcgacgttcatatt
catggggcaaataattatgatatgatggatggctcaacagaaagcatccaagctgtttcg
atggcttgtgcggaaaccggatgtactagtttcttagtcacctcggttagttcttctttt
gaagacttgatccaaatgattaagcaaactaaaaaagtcattggaaaagagaaaggtgcc
aaaattgcaggaattcatttagaaggcccctaccttaatatagaaaaaaaaggaatgcaa
aatccagcctatttaagacaccccgatttaaaagaaatgaaaaagatcttcgatgaagca
gatggtctgataaaaatggtcacaattgctccagaattgcctaggggtatcgaactcatt
gacttcttgaaaaaaagaggagttgtggtcgccattgcacattccaatgcaacttatgaa
gaggcgcaaaatgctttcgaacaaggagcaacccacatcacacattgcttcaatgctatg
ccagccattcatcaccgggcaccaggacttgttacagcagccttggaaaatgattcggta
agcgttcaaaccattgtagacggtgtccatctccatcccggaatcgtgcgccttattcac
aaaattaaaggaccagataaaatggttctcacaaccgatgcccttcaagcaatgggagtt
ggcgacggggagtatatttttggcggtcaccaagtaacggttaaggaaggcatagctcgt
ttaaaagacgggacattagcttcaagtaccgtgacgatgaataaatccttaaagttaagt
aatgaatttgggattcacttacaagacgctattcaaatggcagcaagtacgccggcagac
attttaggaatgaacaattttggtcgaatcgaaaaaggctatgtcgctgatttagtttta
cttgataaaaattttgaagttctaactacatggattgatggtgaaatatattaa

DBGET integrated database retrieval system