KEGG   Listeria monocytogenes CFSAN006122: Y193_08635Help
Entry
Y193_08635        CDS       T03478                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmv  Listeria monocytogenes CFSAN006122
Pathway
lmv00071  Fatty acid degradation
lmv00072  Synthesis and degradation of ketone bodies
lmv00280  Valine, leucine and isoleucine degradation
lmv00310  Lysine degradation
lmv00362  Benzoate degradation
lmv00380  Tryptophan metabolism
lmv00620  Pyruvate metabolism
lmv00630  Glyoxylate and dicarboxylate metabolism
lmv00640  Propanoate metabolism
lmv00650  Butanoate metabolism
lmv00900  Terpenoid backbone biosynthesis
lmv01100  Metabolic pathways
lmv01110  Biosynthesis of secondary metabolites
lmv01120  Microbial metabolism in diverse environments
lmv01130  Biosynthesis of antibiotics
lmv01200  Carbon metabolism
lmv01212  Fatty acid metabolism
lmv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y193_08635
   00630 Glyoxylate and dicarboxylate metabolism
    Y193_08635
   00640 Propanoate metabolism
    Y193_08635
   00650 Butanoate metabolism
    Y193_08635
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Y193_08635
   00072 Synthesis and degradation of ketone bodies
    Y193_08635
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Y193_08635
   00310 Lysine degradation
    Y193_08635
   00380 Tryptophan metabolism
    Y193_08635
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Y193_08635
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Y193_08635
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Y193_08635
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lmv04147]
    Y193_08635
Enzymes [BR:lmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Y193_08635
Exosome [BR:lmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Y193_08635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHY98381
UniProt: A0A0B8RAM1
Position
1721445..1722614
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system