KEGG   Listeria monocytogenes CFSAN006122: Y193_09895Help
Entry
Y193_09895        CDS       T03478                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
lmv  Listeria monocytogenes CFSAN006122
Pathway
lmv00430  Taurine and hypotaurine metabolism
lmv00620  Pyruvate metabolism
lmv00640  Propanoate metabolism
lmv00680  Methane metabolism
lmv01100  Metabolic pathways
lmv01120  Microbial metabolism in diverse environments
lmv01200  Carbon metabolism
Module
lmv_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:lmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Y193_09895
   00640 Propanoate metabolism
    Y193_09895
  09102 Energy metabolism
   00680 Methane metabolism
    Y193_09895
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Y193_09895
Enzymes [BR:lmv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Y193_09895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AHY98627
UniProt: A0A1T1YQ43
Position
complement(1971283..1972476)
Genome map
AA seq 397 aa AA seqDB search
MHKIMAINAGSSSLKFQIFTMPGEEVLVKGLIERIGLPDAIFNMSFQNEKIKEIRAINNH
GEAVEILLEQLKAHQVINDLSEITGVGHRVAHGGEDFVTSCVVTDEVVKGIEAVTNLAPL
HNPANIIGIKTFRELLPNAVSVAVFDTAFHQTIPEENFLYALPYELYEKHHIRKYGFHGT
SHKYVAGKAAEVLEKPLEKLKIISCHLGNGASVCAIEAGKSVNTSMGFTPNAGLMMGTRS
GTIDATIIPYLVDELGYSLDEVMHMMSSESGVLGVSGISSDFRDIEIAAKEGNSRALLTL
RMFTGQICNYIGAYASAMNGCDALLFTAGVGENSPLIRQMVTEQLSYLGVTCHVTKNNAG
DMIISNDDEAVKVCIIPTNEELMIARDVEKYAKQTIS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaattatggcgataaacgcagggagttcttcactgaaattccaaatttttacg
atgccaggagaagaagttttagttaagggcttaattgaaagaatcggtctaccagacgcc
attttcaacatgtcctttcaaaatgaaaaaatcaaagaaatacgagcaatcaataaccac
ggggaagcagtcgagattttactggagcagctgaaggcgcatcaagtaatcaatgatctg
agcgaaattacaggggtcggacatcgtgttgcgcatggcggagaagattttgttacgtcc
tgtgttgtaacagatgaagtggtgaaagggattgaagctgtgacaaaccttgcgccgcta
cataatccagcgaatatcatcggaatcaaaacttttcgtgaattgctgccaaatgcggtt
tctgttgcagtatttgataccgcattccatcaaacgattccagaagaaaactttttatat
gcgcttccttatgaactttatgaaaaacatcatattcgaaaatacggttttcatggaacg
agtcataaatatgtggctggaaaagcagcagaagttctcgaaaaacctttagaaaaatta
aaaattatttcttgtcatttaggcaatggagcgagtgtttgtgcgattgaagctgggaaa
tcagtgaatacttccatgggctttacaccaaatgctggcttgatgatgggaacacgttct
ggtacaattgacgcgacaatcatcccgtatttagtggatgaattaggctatagcttggat
gaagtgatgcatatgatgtctagtgaatcaggtgtccttggcgtatcgggaatttcaagt
gatttcagagatatcgaaattgcagccaaagaaggtaattcacgcgcgctattaacactt
cgtatgtttactggccaaatatgcaactacatcggtgcttatgcctccgcaatgaacggt
tgcgacgcattattatttacagcgggtgtgggtgaaaattcgccattaatccgccaaatg
gtaacagaacagctaagttatcttggtgtaacatgccatgtgacaaaaaataatgcgggt
gatatgataattagcaatgatgatgaagcggtcaaagtgtgcattattccaaccaatgaa
gaactaatgattgctcgcgatgtagaaaagtatgcaaaacaaacgataagttaa

DBGET integrated database retrieval system