KEGG   Listeria monocytogenes CFSAN006122: Y193_14065Help
Entry
Y193_14065        CDS       T03478                                 

Definition
(GenBank) short-chain dehydrogenase
  KO
K22251  glycerol dehydrogenase [EC:1.1.1.6]
Organism
lmv  Listeria monocytogenes CFSAN006122
Pathway
lmv00561  Glycerolipid metabolism
lmv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Y193_14065
Enzymes [BR:lmv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Y193_14065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C RmlD_sub_bind DUF853 3HCDH_N 3Beta_HSD Ldh_1_N zf-C4H2
Motif
Other DBs
NCBI-ProteinID: AHY99426
UniProt: A0A0B8R5F2
Position
2768977..2769741
Genome map
AA seq 254 aa AA seqDB search
MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIKEDVKDVAAKINPS
RTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNL
KGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAP
YNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLI
TGENLIIDGGYTIK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaaaggttttgataaagattttaacattacagacaaagtagccgtggtaact
ggggcagcaagcgggattggtaaagcaatggcagaacttttttccgaaaaaggcgcttat
gttgtcttgcttgatattaaagaagatgtaaaagatgtcgcagcaaaaatcaatccatca
agaacgctagcacttcaagtcgatattacgaagaaagaaaacatcgaaaaagtcgttgcc
gaaatcaaaaaagtctatccaaaaatcgatattttagccaattcagctggtgtcgcactt
ctcgaaaaagcagaagatttaccagaagagtactgggataaaacaatggaactgaactta
aaaggttcgttcctaatggcgcaaattatcggtcgcgaaatgattgcaactggcggcggt
aaaatcgttaatatggcctctcaagcttctgttattgcacttgataaacacgttgcctac
tgcgctagtaaagcagcgattgtttctatgacgcaagtgctagcaatggaatgggcgcct
tacaacattaatgtcaatgcgatttccccaaccgttatcttgacggaacttggcaaaaaa
gcttgggcaggtcaagtcggcgaagacatgaaaaaattaattccagccggtagatttggt
tatccagaagaagttgccgcatgcgccctctttttagtaagtgacgcagcgagccttatt
actggggaaaacctaattatcgacggtggttatacgattaaataa

DBGET integrated database retrieval system