KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_0189Help
Entry
LMOSLCC2755_0189  CDS       T02219                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
lmw00900  Terpenoid backbone biosynthesis
lmw01100  Metabolic pathways
lmw01110  Biosynthesis of secondary metabolites
lmw01130  Biosynthesis of antibiotics
Module
lmw_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2755_0189 (ispE)
Enzymes [BR:lmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LMOSLCC2755_0189 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBY47781
Position
193557..194438
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggacggctatcatgaggtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaagcacactttatt
ccagaagatcgtcgcaatttaatttatcaagcagccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcacattcctgtttctgcgggtcttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcggaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactgggcgcggggaaaagatttctgcgttacctaat
attcctggttgttggattgtgcttgctaaaccgagcattagcgtgtctaccccgactatc
tataaagaacttcaagtagataacgtagaacacccagacacacaaaaaatgattgaatcc
attaaaaatggcgatttagacgggatatttgcgtctacaggaaatgtattagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggccctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaataattaa

DBGET integrated database retrieval system