KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_0413Help
Entry
LMOSLCC2755_0413  CDS       T02219                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LMOSLCC2755_0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ferlin_C Myc_target_1
Motif
Other DBs
NCBI-ProteinID: CBY48005
Position
437956..438963
Genome map
AA seq 335 aa AA seqDB search
MDTVILITVIIVIMGLAFDFINGFHDIANAVATSISTRALKPRVAIGIAAVMNFLGAISF
TGVAESLTKSIVDPFSLNNGEFVVLCGLIAAVIWNLMTWLVGMPSSSSHALIGAIAGASI
ASASSFSVLNWSGFTTIIIALIISPIIGFTVGYLIYSLFKHLFHDKKLGKMNRRFRFIQI
GTAAAQAYSHGTNDAQKTMGIITLALVASGLLKESAGIPFWVQVSCAASMAIGSSVGGYR
IIKTVGTKIMKITPVTGVASDLSSLSVIMTATLIHLPVSTTQVIDSSIMGVGTANHKKEV
NWRTGKNMVVTWFITLPLAGLLAAVVYWISAAIFL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatacggttattttaattacggttattatcgttataatgggcttagcatttgatttt
ataaatggatttcatgatattgcaaatgctgtggccacaagtatttcaactagagcttta
aaaccgcgagtggcaattggaattgcggcagtcatgaattttctgggagccatttcgttt
accggagtagctgaatcgctcaccaaaagtattgtagatccattttcgcttaataatgga
gagtttgtcgttttatgcggcttaattgcggcagtgatttggaatttgatgacttggctt
gttggcatgcctagtagttcctcgcatgcgcttatcggtgcgatagctggggcctccatc
gcatcagccagtagttttagcgtgcttaattggtcaggatttacaactattattattgca
ctcattatctcgccgattatcggttttacagtaggttatttgatttattcactctttaag
catctttttcacgacaaaaagcttgggaagatgaatcgacgctttcgttttatccaaatt
ggaacagctgccgcccaagcatattcacacggcacaaatgatgcccaaaaaacgatggga
attatcacgcttgctttagttgcgagtgggcttttgaaagagtcagctggtattcctttt
tgggtgcaagtaagttgtgcggcatcgatggcgattggatcgtctgttggtggttatcga
atcatcaaaacagtaggaactaaaatcatgaaaatcaccccagttacaggtgttgcgtcc
gatttaagctcactttctgtaatcatgacagctactttgattcatttgccagtcagcact
acgcaagttattgacagctcgattatgggtgtcggaacagctaaccataaaaaagaagtc
aattggcgtacggggaaaaatatggttgtaacttggtttatcacgttaccactagctgga
cttttagcggcagtggtatactggatatcagcagctatttttttataa

DBGET integrated database retrieval system