KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_0957Help
Entry
LMOSLCC2755_0957  CDS       T02219                                 

Gene name
nagA-1
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Pathway
lmw00520  Amino sugar and nucleotide sugar metabolism
lmw01100  Metabolic pathways
lmw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMOSLCC2755_0957 (nagA-1)
Enzymes [BR:lmw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     LMOSLCC2755_0957 (nagA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CBY48549
Position
989649..990782
Genome map
AA seq 377 aa AA seqDB search
MTNKVITNATIYTGKGVLENAFVRFDKQILEVGSMADFQADKAEEVIDAKGQKLVPGFID
VHSHGGYSFDAMDADPEALRKQVNGMLNEGITTYFPTTMTQSHENIEKALKVINEVAQTE
PVIGGIHLEGPFVSKVFKGAQPEEYIQAPDLELFKKWYDISGGLIKLVTYAPEHDTSADF
ENLCFELGVVPSIGHSNDVREHLKTSKATHATHLYNACHRMTHREPGVPGHVLLERGINA
ELIVDGIHVHPDMVKLAYQMKGPEHLCIITDSMRAKGMPEGKSELGGQTVIVKDKQARLE
DGTLAGSVLTYDDGFRNMIKFTGCSVEEAVLMSSGNQAREFNLTQKGAIEAGKDADFNLL
DEDLHITATYSFGKKHS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactaataaagtaattactaacgctacaatttatactggtaaaggtgttctagaaaat
gctttcgtacgttttgacaaacaaattttagaggttggctcgatggctgatttccaagcg
gacaaagcagaagaagtaatcgatgccaaaggacaaaaacttgttccaggtttcattgat
gttcattcccacggtggttatagttttgacgcaatggatgcagatccagaagcacttaga
aaacaagtgaacggaatgttaaatgaaggaattactacttacttcccaacaacgatgaca
caatcacatgaaaatattgaaaaagcattaaaagtgatcaatgaggttgctcaaacagaa
cctgttattggtggaattcatttggaaggtccatttgtttctaaagtctttaaaggcgca
caaccagaagaatatattcaagcacctgacttggaacttttcaaaaagtggtatgatatt
tctggtggtttaattaaattagtaacatatgcaccagaacacgatacttcagctgatttt
gaaaatttgtgttttgaactaggggttgttccgagtattggtcactctaatgatgttcgt
gagcacttgaaaacaagtaaagcgacacacgcgacacatttatataatgcttgtcaccgt
atgacgcaccgtgagccaggcgttccaggtcatgttttactagaacgcggtattaatgca
gaactaatcgttgatggtattcacgttcatcctgatatggtgaaattagcttatcaaatg
aaagggccagaacatttatgcattatcactgactccatgcgagcaaaaggtatgccagaa
ggaaaatctgaacttggcggccaaactgttatcgtgaaagataaacaagctcgtttggaa
gatggaactttagctggaagtgtactcacttatgacgatggcttccgcaacatgattaaa
tttactggatgctcggtagaagaggcagttcttatgtcttctggaaaccaagcacgcgaa
tttaatttaacacaaaaaggtgcaatcgaggctggtaaggatgcagatttcaacttactt
gacgaagatttacacattacagcaacttattcattcggaaaaaaacattcttga

DBGET integrated database retrieval system