KEGG   Listeria monocytogenes SLCC2755: LMOSLCC2755_1419Help
Entry
LMOSLCC2755_1419  CDS       T02219                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmw  Listeria monocytogenes SLCC2755
Pathway
lmw00071  Fatty acid degradation
lmw00072  Synthesis and degradation of ketone bodies
lmw00280  Valine, leucine and isoleucine degradation
lmw00310  Lysine degradation
lmw00362  Benzoate degradation
lmw00380  Tryptophan metabolism
lmw00620  Pyruvate metabolism
lmw00630  Glyoxylate and dicarboxylate metabolism
lmw00640  Propanoate metabolism
lmw00650  Butanoate metabolism
lmw00900  Terpenoid backbone biosynthesis
lmw01100  Metabolic pathways
lmw01110  Biosynthesis of secondary metabolites
lmw01120  Microbial metabolism in diverse environments
lmw01130  Biosynthesis of antibiotics
lmw01200  Carbon metabolism
lmw01212  Fatty acid metabolism
lmw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmw00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOSLCC2755_1419
   00630 Glyoxylate and dicarboxylate metabolism
    LMOSLCC2755_1419
   00640 Propanoate metabolism
    LMOSLCC2755_1419
   00650 Butanoate metabolism
    LMOSLCC2755_1419
  Lipid metabolism
   00071 Fatty acid degradation
    LMOSLCC2755_1419
   00072 Synthesis and degradation of ketone bodies
    LMOSLCC2755_1419
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOSLCC2755_1419
   00310 Lysine degradation
    LMOSLCC2755_1419
   00380 Tryptophan metabolism
    LMOSLCC2755_1419
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2755_1419
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOSLCC2755_1419
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LMOSLCC2755_1419
Enzymes [BR:lmw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOSLCC2755_1419
Exosome [BR:lmw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC2755_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CBY49011
Position
complement(1427796..1428965)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAANAQEKNLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILEKA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaatttggtggtagt
ttgaaagacatcagtgcagtagaccttggcgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgggtggatcaagtgatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtttgtggatctggcttaaaatcggttatgcttggtaggcaa
gcaattcagctaggggaggctgacatcgtagccgttggtgggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagctggcgaagaaatcgatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgagtatcacatgggaattact
gcagaaaatgttgcagagaaattctccgtaaccagagaagaacaagatgaatttgcccat
aactcacaaatgaaggccgcgaatgcacaagaaaaaaacctttttgaagaggaaattatt
cctgtaaagcttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctactttgaaaagcgtattcaaagaaggtggaacggttacagcc
ggcaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaagttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgacattgatttattccatttaaacgaagcttttgcatcgcagtca
gttgcagtggctcgtgatttaaaaattccagaagagaaacttaatatttacggtggagca
attgcactaggccatccaattggagcttctggtgcacgcattattgcctcattgttaaat
gagttaaaacatgaaaataagcacatcggtgtcgcttccttgtgtgttggtggtggtatt
ggtattgcaattatccttgaaaaagcttga

DBGET integrated database retrieval system