KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_1574Help
Entry
LMOSLCC2755_1574  CDS       T02219                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Pathway
lmw00020  Citrate cycle (TCA cycle)
lmw00480  Glutathione metabolism
lmw01100  Metabolic pathways
lmw01110  Biosynthesis of secondary metabolites
lmw01120  Microbial metabolism in diverse environments
lmw01130  Biosynthesis of antibiotics
lmw01200  Carbon metabolism
lmw01210  2-Oxocarboxylic acid metabolism
lmw01230  Biosynthesis of amino acids
Module
lmw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LMOSLCC2755_1574 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LMOSLCC2755_1574 (citC)
Enzymes [BR:lmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LMOSLCC2755_1574 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CBY49166
Position
complement(1588542..1589804)
Genome map
AA seq 420 aa AA seqDB search
MSQKIQVENGVLKTPNNPVIPFIEGDGTGPDIWAAAKRVLDAAVKKAYNGEKEIAWKEVL
AGEKAFKQTGEWLPQATLDTIDEYLIAIKGPLTTPIGGGIRSLNVALRQELDLYVCLRPV
RYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEFKEGSEESKKLIDFLKSEFGVDKIRFP
ETSGIGIKPISKEGTERLVRSAIEYAIKEGRKSLTLVHKGNIMKFTEGAFKNWGYDLCER
EYGDKVFTWNEYDRIKEAEGTEVADAKQKEALAAGKILVKDSIADIFLQQILTRPAEFDV
VATMNLNGDYISDALAAQVGGIGIAPGANINYLTGHAIFEATHGTAPKYAGLDKVNPSSV
ILSGTLLLEHIGWGEAAALINQSMEKTIAAKTVTYDFARLMDGATEVKCSEFADELIKNF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaaaattcaagtagaaaacggtgtgctcaaaacaccaaacaacccagtcatt
ccttttattgaaggggacggaactggtccagacatctgggcagctgcaaaacgcgtttta
gatgccgcagtaaaaaaagcttacaatggcgaaaaagaaattgcttggaaagaagtacta
gctggtgaaaaagcatttaaacaaacaggagaatggttaccacaagcgactttagataca
attgatgaatatttgattgctattaaaggaccgcttactactccaatcggtggaggcatt
cgttcgttaaacgttgccctgcgccaagagttagatttatatgtttgtttacgtccagtt
cgttatttcaaaggcgttccttcaccggtgaaacgtccggaagacacagatatggtcatt
ttccgtgagaatacagaagatatatatgcagggattgaatttaaagaaggcagcgaagaa
tcaaaaaaactaatcgacttcttaaaatctgagtttggcgttgacaaaattcgtttcccg
gaaacttctggtattggtattaagccaatttccaaagagggaacagagcgtttagtgcgt
tcggcgattgaatatgcaattaaagaaggtcgtaaatcattaacgcttgtacacaaaggg
aatatcatgaaattcacagaaggagctttcaaaaattggggctatgacttatgtgaacgc
gaatatggcgataaagtatttacttggaatgagtatgatcgcattaaagaagcagaagga
acagaagttgctgatgcgaaacaaaaagaagcgcttgctgctgggaaaattttagtcaaa
gattcgattgcggatattttcttgcaacaaatcttaactcgcccggctgaatttgatgta
gttgctacaatgaacttgaatggagattacatttctgatgcacttgctgctcaagtaggc
ggaatcggtattgctccaggagcaaacattaactacttaactggccatgcaattttcgaa
gcgacgcatggtactgcaccgaaatatgcaggtcttgataaagtgaatccttcatcagtt
attttatctgggacacttcttcttgaacatattggttggggtgaagcggctgcattaatt
aatcagtcaatggaaaaaacaatcgctgcgaaaaccgtaacttatgattttgctcgatta
atggatggtgcgacagaagttaaatgttcggaatttgcagatgaattaataaaaaatttc
taa

DBGET integrated database retrieval system