KEGG   Listeria monocytogenes SLCC2755 (serotype 1/2b): LMOSLCC2755_1937Help
Entry
LMOSLCC2755_1937  CDS       T02219                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
lmw  Listeria monocytogenes SLCC2755 (serotype 1/2b)
Pathway
lmw00670  One carbon pool by folate
lmw01100  Metabolic pathways
lmw01120  Microbial metabolism in diverse environments
lmw01200  Carbon metabolism
Module
lmw_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:lmw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LMOSLCC2755_1937 (fhs)
Enzymes [BR:lmw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     LMOSLCC2755_1937 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: CBY49529
Position
complement(1989180..1990862)
Genome map
AA seq 560 aa AA seqDB search
MSNKVKSDIEIASKAEILPVTTIAEHLGLDADALELYGKYKAKLSYDTIHSLKDKEPGKL
VLVTAINPTPAGEGKSTVTVGLGDALSKKDKKTVIALREPSLGPTMGIKGGATGGGYAQV
IPMEDINLHFTGDFHAITAANNALSAFIDNHMQQGNDLDIDGRRIVWKRVVDLNDRALRK
VVVGLGGPIQGVPREDGFDITVASEIMAIICLASDLKDLKKRLSEIVIGYNYKKEPITVG
EMGYEGALTLLLKDALKPNLVQTLEHTPAIVHGGPFANIAHGCNSVSATSTALRLGEYVV
TEAGFGADLGAEKFLDIKVPALGKAPDCVVIVATIRALKMHGGALKTELSEENVDALAKG
FTNLQKHTESIQTFGIPYVVAINKFITDSDAEVAKLEALCEEHGIPFSLTEVWEKGGDGG
LELADKVIAAVESGEADYKRIYDDAWSIEEKLEAIVTKVYGGIGVELSSKAQKQIVEFKK
YGWDRYPICMAKTQYSLSDDPTLLGRPTDFVIHIREFIPKLGAGFVVALTGDVMTMPGLP
KKPAALNMDVDENGNAQGLF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaagtgaaatcagatattgaaattgcatcaaaagcagaaattctaccagtt
acgactattgcggaacatttaggactagacgcagatgcactcgaactttacggaaagtat
aaagcaaagttatcctatgataccattcactcgctaaaagataaagaaccaggaaaactt
gttcttgttacggcgattaacccaacgcctgctggtgaagggaaatcgacagtgacagtt
ggtcttggcgacgcactctctaaaaaagataagaaaaccgttattgcacttcgcgaacca
tcgctcggacctaccatgggtattaagggcggggcaacaggtggcggatacgcgcaggtt
attccaatggaagatattaatttacattttactggtgatttccacgcaattacagcagct
aataatgctttatcggcatttattgataaccatatgcaacaagggaatgacctagatatt
gacggtagaagaatcgtttggaaacgtgtagttgatttgaacgaccgtgcacttcgaaaa
gtggttgttggtcttggaggtcctattcaaggggttccacgtgaagacggttttgatatt
acggttgcttctgaaattatggcgatcatttgtttagcaagtgatttaaaagatttaaag
aaacgtttaagtgaaatcgtgatcggttataactataaaaaagaaccaattacagttggc
gaaatgggctacgaaggcgctctaaccttactattaaaagatgctttaaaacctaatttg
gtgcaaacattagaacatacacctgccatcgtacacggtggaccttttgctaatattgct
cacggatgtaatagtgtttctgcgacaagcacagcacttcgactaggtgagtatgtagtg
acagaggctggatttggtgcagaccttggtgccgagaaatttttagatattaaagttcct
gcccttggaaaagcgccagattgcgttgttattgtagcaacgattcgcgcactgaaaatg
cacggtggcgctttgaaaaccgagcttagcgaagaaaatgtggatgcgctagctaaaggt
tttactaatttacaaaaacatacggaatctattcaaacatttggtattccttatgttgta
gccattaataaattcattaccgattctgacgcagaagtagcgaaattagaagcactttgc
gaagaacacggcattcctttctctctgacagaagtttgggaaaaaggcggcgacggtggc
cttgaactcgcggataaagtcattgcggctgttgaaagtggcgaagcggactacaaacgc
atttatgatgatgcgtggtcgatagaagaaaaactagaagcgattgtgacgaaggtttac
ggtggtattggtgtggaactttccagcaaggcgcagaaacaaatcgttgaattcaaaaaa
tatggttgggaccgctatccgatttgtatggcgaaaacccaatattccttatcggatgac
ccaacattacttggacgcccaactgattttgttattcacattcgcgaattcattccaaaa
cttggtgctggttttgtcgttgctttaacaggcgatgtaatgacgatgccaggtttaccg
aaaaaaccagcggcacttaatatggatgtcgatgaaaatgggaatgcacaaggtttattt
taa

DBGET integrated database retrieval system