KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_0018Help
Entry
LMOSLCC2372_0018  CDS       T02220                                 

Definition
(GenBank) glycosyl hydrolase, family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
lmx00010  Glycolysis / Gluconeogenesis
lmx00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2372_0018
   00500 Starch and sucrose metabolism
    LMOSLCC2372_0018
Enzymes [BR:lmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOSLCC2372_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: CBY53353
Position
21652..23085
Genome map
AA seq 477 aa AA seqDB search
MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPSKALATDY
GFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVF
DECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTF
NEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLA
AGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDA
LRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITM
NTIYDRYQKPLFIVENGLGAVDTVEEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYT
PWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaatttcctaaagactttttatggggcggagcagttgctgccaaccaa
tgtgaaggagcttatcttgaagacggtaaaggactttcacttgttgatatccttccaaca
gtagaggacggacgttgggaagctttattcaatccatcgaaagcgcttgctacagattat
ggtttttacccaagtcacgaatcaattgatttttatcatcgttataaagaagacattaaa
ttaatggctgaaatgggattcaaatgtttccgtatgtccatcagttggccacgtattttc
ccgaatggtgatgaaacgacaccaaatgaaaaaggtttagcattttatgatgcagttttt
gatgaatgtcacaaatatggtatcgaaccagttgttacaatcaaccattttgatactccg
ctagaagttttcaaaaaatatggtggttggaaaaatcgtaaatgcatcgacttttacttg
aatttctgtgaagcaattttcacgcgttataaagataaagtaaaatattggatgacattt
aatgaaattaacatgattcttcatcttccatacattggtggaggtttagacgttactaaa
gaggataatccagaggaagttaaatatcaagctgctcatcatcaattagttgcatcagca
cttgcaactaaacttggtcatgaaatcaatcctgaaaatcaaatcggttgtatgcttgca
gcgggtaacacatatccaatgacttgtaatccaaaagatgtctggaagtctatcgaggcg
gaccgtgaaggctacttcttcattgatgttcaagcacgcggatactacccaagctacact
aaacgtttcttcaaagaacataacatcaacatcaaaatggaagatggcgacttagacgca
ttacgcgatcacacagttgattatgtggcattcagctactattcttctcgtctaacaagc
gcagatccagagaaaaacaaagaaacagaaggcaacgttttcgcaacactaaaaaaccca
tacctaaaagcaagcgaatggggctggcaaattgatccactaggtctacgtattactatg
aatacaatttacgaccgttaccaaaaaccacttttcatcgttgaaaatggcttaggtgca
gtggatactgtggaagaagacggctcaatcactgacgattacagaatcgactacatgcgt
gaacatgttcgcgaaatgggcgaagcaatcgaggacggagtagaacttcttggctataca
ccgtggggctgcatcgatcttgtcagcgctggctctggcgaaatgaaaaaacgctacggc
ttcatctatgttgaccgcgacaacaaaggcaacggaacattaaaccgctcgaagaaaaaa
tcattcgactggtacaaaaaagtaattgaaacaaatggtaaagatatcgactag

DBGET integrated database retrieval system