KEGG   Listeria monocytogenes SLCC2372 (serotype 1/2c): LMOSLCC2372_0317Help
Entry
LMOSLCC2372_0317  CDS       T02220                                 

Definition
(GenBank) TENA/THI-4 family protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
lmx  Listeria monocytogenes SLCC2372 (serotype 1/2c)
Pathway
lmx00730  Thiamine metabolism
lmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LMOSLCC2372_0317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lmx03000]
    LMOSLCC2372_0317
Enzymes [BR:lmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     LMOSLCC2372_0317
Transcription factors [BR:lmx03000]
 Prokaryotic Type
  Other transcription factors
   Others
    LMOSLCC2372_0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 NOG1_N
Motif
Other DBs
NCBI-ProteinID: CBY53652
Position
340250..340924
Genome map
AA seq 224 aa AA seqDB search
MFIHGFQEEVGNLWQETLRHPFVRSLADGTLEKEAFYYYLLQDDYYLSHFEKVIEKSVEQ
AGTAELAAEMREVQVRLQQSELLMREQFYPRVGLTERDFSERKPAPTAYHYTSHLHRMVD
FGSFGVTIAALLPCYALYADIGKMYEGARSSEPFYQELLDSYVDENYQKVVLQQKRLVEQ
AASMADARELALMKQAFQISVEMEWAFFDMAYKKQNWRGSVNYV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgtttattcacggttttcaggaagaagtagggaatttatggcaagaaacgttgcggcac
ccatttgtgcggagtttggcggatgggacgcttgagaaggaggcgttttactattatttg
ttacaagatgattattatttgtcgcattttgagaaggtgattgagaagagtgtggagcag
gctgggacggcggaacttgctgcggaaatgagggaagtacaggtgcggcttcagcagtcg
gaattgttgatgcgcgaacagttttatccgcgggttgggctaacggagcgtgatttttcc
gagcgaaaaccggcgccaactgcttatcattatacttctcaccttcatcggatggtggat
tttggaagttttggggtgacgattgcggcgcttttgccgtgttatgcgctttatgcggat
ataggaaaaatgtacgaaggggcgcggagttcggagccattttatcaagagttgttggat
agttatgtggatgaaaattatcaaaaagtggtgttgcagcagaaacggttggtggaacag
gcggcgagtatggcggatgcgcgggaactggccctcatgaagcaggcttttcaaattagt
gtggaaatggaatgggcgttttttgatatggcttataaaaaacaaaattggcgtgggagt
gtgaattatgtttga

DBGET integrated database retrieval system