KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_1634Help
Entry
LMOSLCC2372_1634  CDS       T02220                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
lmx00010  Glycolysis / Gluconeogenesis
lmx00030  Pentose phosphate pathway
lmx00051  Fructose and mannose metabolism
lmx00052  Galactose metabolism
lmx00680  Methane metabolism
lmx01100  Metabolic pathways
lmx01110  Biosynthesis of secondary metabolites
lmx01120  Microbial metabolism in diverse environments
lmx01130  Biosynthesis of antibiotics
lmx01200  Carbon metabolism
lmx01230  Biosynthesis of amino acids
lmx03018  RNA degradation
Module
lmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2372_1634 (pfk)
   00030 Pentose phosphate pathway
    LMOSLCC2372_1634 (pfk)
   00051 Fructose and mannose metabolism
    LMOSLCC2372_1634 (pfk)
   00052 Galactose metabolism
    LMOSLCC2372_1634 (pfk)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2372_1634 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LMOSLCC2372_1634 (pfk)
Enzymes [BR:lmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMOSLCC2372_1634 (pfk)
Protein phosphatases and associated proteins [BR:lmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMOSLCC2372_1634 (pfk)
Messenger RNA biogenesis [BR:lmx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LMOSLCC2372_1634 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBY54969
Position
complement(1630589..1631548)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgcgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatt
ggtggagatggttcttaccacggagcggaagcacttacaaaacgtggattcccaaccatt
ggtatcccaggaactattgataatgatatttctggaactgattttactattggttttgat
acagcgttaaatactgttcttgatgcacttgataaaatccgcgatacagctacaagtcac
gaacgtactttcattattgaagttatgggtcgcgacgctggtgatatcgctctttggtct
ggtcttgctggtggcgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggcaaaaaacatagtattatcgtcgta
gctgaaggcgtaatgtctggtaatgaatttgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccgactgcatttgac
cgtgtacttgcaagtcgtcttggtgcacgttcagtagaattattgctagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgagattttg
aaagaaaaacacactcttgatcaaaaattatttgatcttgcatcaattttgtcgatttaa

DBGET integrated database retrieval system