KEGG   Listeria monocytogenes SLCC2372: LMOSLCC2372_1695Help
Entry
LMOSLCC2372_1695  CDS       T02220                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmx  Listeria monocytogenes SLCC2372
Pathway
lmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmx01100  Metabolic pathways
lmx01110  Biosynthesis of secondary metabolites
lmx01130  Biosynthesis of antibiotics
lmx01230  Biosynthesis of amino acids
Module
lmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmx00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC2372_1695 (trpC)
Enzymes [BR:lmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LMOSLCC2372_1695 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CBY55030
Position
complement(1692999..1693757)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKEVEVAKMPLEQVAEKRKTYSFYEFLKANTNTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVGIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEKLITLFEQALALDLEVLVEVHDQEELAVAQKIGAQLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYDAVLVGEALMREAT
PEVAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagaagtagaagttgcaaaaatgccctta
gaacaagtagcagaaaaacggaaaacttattcgttttatgaatttttaaaagcaaataca
aacacgatgcaacttattgcagaagtaaaacgcgcctctccttccaaaggggaaatcaat
atgggcgtgaatccagttctgcaagccaagtcttatcaagccgcgggtgcgggaatgatt
tctgttttgacagatcctgtttttttcaaaggctcgattgaagatttgcgagaagtagcg
aaaaatgtgggaattcctgtactctgtaaagatttcattattagtgaaaaacaattgatt
cgcgctcgaaatgcgggagcgacggttgtgttgttaattatttcggcacttacagaagag
aagctaatcaccctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccaggaagaattagctgttgctcaaaaaatcggagctcaactcattggtgtaaac
aatcggaatttgcacacatttgaagtggatattgcagtaagcgaaagactggcgagtgat
ttttcgtcggatgcttgttttataagcgaatcaggttttcgaacagcagaagatgtggct
cgcgtgagtcaaaaatatgatgcggtacttgttggagaagcgttaatgcgagaagcgact
ccagaagtggcagcgaagagtttgaaggtgacacgatga

DBGET integrated database retrieval system