KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0864Help
Entry
LM5923_0864       CDS       T01164                                 

Gene name
fbp
Definition
(GenBank) hypothetical protein
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00010  Glycolysis / Gluconeogenesis
lmy00030  Pentose phosphate pathway
lmy00051  Fructose and mannose metabolism
lmy00680  Methane metabolism
lmy01100  Metabolic pathways
lmy01110  Biosynthesis of secondary metabolites
lmy01120  Microbial metabolism in diverse environments
lmy01130  Biosynthesis of antibiotics
lmy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LM5923_0864 (fbp)
   00030 Pentose phosphate pathway
    LM5923_0864 (fbp)
   00051 Fructose and mannose metabolism
    LM5923_0864 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LM5923_0864 (fbp)
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LM5923_0864 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: ADB70708
Position
complement(862337..864283)
Genome map
AA seq 648 aa AA seqDB search
MKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNGSGVVK
RKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELCQYVAS
KYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISALSLLI
QQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVCAANVI
RISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEITQIARM
HKAISIIQFKLEGEIIKRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFPTINPE
NPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPLHKDGT
FMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSLFGKSE
MTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPVKEGKG
ESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIKNETDI
LSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttacgcttgttagcaaaagaatatcctactatcgccaagacagctacggaa
atcattaacctcgaagcaattatgaaccttccaaaaggaacggaacattttttaagtgat
gttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggttctggtgttgtaaaa
cggaaaattcgtgatatttttggcgcagagctagatgatgcagagattaattcacttagt
acactgatttattatccagaagaaaagatggatttgattgctagtgaaacagaagatttg
catgcttggtatcgcaccacactttttcgtttgattgaactctgccagtatgttgcttca
aaatacacacgttctaaagttagaaaagccatgccagaagattttgcctacatattagaa
gagttacttcatgaaaactacaatgaagacgataaaaagctttattatgaagaaatttta
caacatattatttcacttggtcgtgcagaagaatttattagcgctctctcgctacttatt
caacaattggtcgtggatcatttgcacattgttggtgatgtttatgatcgtggcccttat
ccagataaaatcatggatacattaatgaattaccattcgctcgatttccagtggggtaat
cacgatattttatggatgggcgcggctagtggctctagggtttgtgcggctaatgttatt
cggatttctgctcgctatttaaatttagatattttagaagatagttacggtatttccctt
cgccccctagccctttttgccgacgaagtgtacaaagacgatccttgtacctacttccag
ccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacgcaaattgctaggatg
cacaaggctatctcgattattcagtttaaattggaaggtgaaattattaaacgacgcaaa
gaatttgatatgaatcatcggcttttacttcaatttatcgattacaaaaaaggcacaatt
caactaaaaggaaaagaataccagttgttagacaatcattttccaacgattaatccagaa
aatccttatgaacttactgatgcggagagagaacttattgggaaaattactgccgctttt
aaaaactgccgccgattgcaaaaacatgtacaatttctatattcaaaaggcagcatgttt
ttaacttataatggcaatttactctaccatggctgcattccgctccacaaagatgggact
tttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcgcttttagagcagttt
gaaatacttacccgcgaagcatacgtccgcccaactggaacaaaagaaaagaaatatgcg
tgtgatatcgtttggtatttgtggactggtgccatttcttcgctattcggaaaaagtgaa
atgactacgtttgaacgttattttgttgcagaaaaagaaacccacacagaggaaaaaaat
ccttattataaattgcgtaataacgaattaatttgcaaacaaattttagaagaatttgag
cttgacggagaatgcgggcatatcattaacggccatacgccagtcaaagaaggaaaaggt
gaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggcgggttcgcaaaagca
tatcataaagagacaaacttagcgggttatacactacttttcaacagttacggtttacaa
ctagttagtcatcagccatttactacaaaagaggatgctatcaaaaatgaaacggatatt
ctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgtgtaagggataccgat
attggggctaaacttagtgaacaggcagaagatttaaaattgctactagatgcttatcgt
aatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system