KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0872Help
Entry
LM5923_0872       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K08151  MFS transporter, DHA1 family, tetracycline resistance protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmy02000]
    LM5923_0872
   01504 Antimicrobial resistance genes [BR:lmy01504]
    LM5923_0872
Transporters [BR:lmy02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    LM5923_0872
Antimicrobial resistance genes [BR:lmy01504]
 Gene variants
  Tetracycline resistance genes
   Transporters
    LM5923_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr PUCC MFS_3
Motif
Other DBs
NCBI-ProteinID: ADB70716
Position
complement(873254..874474)
Genome map
AA seq 406 aa AA seqDB search
MFQSKSRTSLTNKKTLLFGLISVFLCGMGFSIIMPVVPFLVTPYVTNASDQALMVTLLTS
VYAFCVFFAAPGLGALSDRFGRRPVLLICFIGSAIGYFIFGLGGALWVLFLGRIIEGITG
GSISTLFAFFADITPQEERTKYFGWVSAAAGAGAALGPAFGGLLAHFGYAMPFFFGATIT
FINFLFGYFYMPESLDDANRLKRIPLMRLNPFSQLLNILTIKNLGRLLIAAFFIWVPNGS
LQAVMSQFAIDSFSWKPALIGMMFSIMGIQDILSQAFVMPKLLIRLTDKQIAVLGMIAEI
IGYSLIATSSIFTLAPLLVIGMFVFGFGDSIFGPSFNGMVSKAASASEQGRIQGGSQAIQ
SLARIIGPIIGGQIYITLGHAAPAIMGVLLITVAIFILYKKTSLAK
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatctaaatctagaacttctttaactaataagaaaactttacttttcggtctt
atatctgttttcctctgtggaatgggttttagtattattatgcccgttgtcccttttctc
gtgacaccttatgtaacaaatgctagtgatcaagcgcttatggtgacactgctcacatcg
gtttacgcattttgcgtattctttgctgcgcctggacttggtgctttaagtgatcgtttt
ggcagacgcccggttttactaatttgctttattggctctgccattggttactttattttt
ggtcttggtggggcgctttgggtactctttcttggtcgaattatcgaaggaattactggt
gggagtattagtacgctgtttgctttcttcgctgatattacacctcaagaggagcggacg
aaatattttggctgggtaagtgctgctgcaggtgcgggcgctgcgcttggtccagctttc
ggtggtttgcttgcccactttggttatgctatgccatttttctttggcgcgacgattact
ttcattaacttcttattcggttatttttatatgcctgagagtttagacgacgcaaatcgt
ttaaaacgaattccgctaatgcgactcaatccgttttcccagctgcttaacattctgacc
atcaaaaacttagggcgtttactgattgcggcatttttcatttgggttccaaatggttcg
ttgcaagctgtcatgtctcaatttgccatcgatagtttcagttggaagccggctttaatc
ggaatgatgttctcaattatgggcattcaagatatcctgtcacaagctttcgtaatgccc
aaacttttaatcagattaacggataaacaaattgctgttcttggaatgattgcggagatt
atcggatattcgcttattgcaacttcctcgattttcacacttgctccattactcgttatt
ggtatgttcgtgtttggattcggtgactcgattttcgggccctctttcaacggaatggtt
tcaaaagctgccagcgctagtgaacaaggtcggattcaaggtggtagtcaagccattcag
tctttggcgcgtattatcggacctattatcggtgggcaaatttatattacccttggccat
gccgctcctgctattatgggtgtccttttaataactgttgcaatttttatcctttacaaa
aagacttctttagcaaaataa

DBGET integrated database retrieval system