KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0874Help
Entry
LM5923_0874       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K01537  Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LM5923_0874
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     LM5923_0874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase Hydrolase_3 HAD
Motif
Other DBs
NCBI-ProteinID: ADB70718
Position
875283..877925
Genome map
AA seq 880 aa AA seqDB search
MEIYRKSAAETFTQLEATEKGLTTSEVTKRQEKYGFNELKNKKKDPLWKLFLETFKDPMV
IVLVIAALVQLVLGEVVESLIIFLVLIVNSIISVVQTRKAESSLDALREMSAPVAKVIRD
GSKQSIHARELVPGDVVILDAGDFVPADGRLFESGSLKIDEGMLTGESEAVEKYIDTIPD
EVGLGDRVNMVFSGSLVVYGRGMFVVTGTASETEIGKIAGLLETAEAKQTPLQRKLESFS
KKLGLGILALCVLIFAVEAGRVLLGDNSADMATAILNAFMFAVAVAVAAIPEALSSIVTI
VLAVGTNKMAKQHAIIRKLPAVETLGSTSVICTDKTGTLTQNKMTVVDYYLPDGTKENFP
ESPENWSEGERRLIHIAVLCNDSNINSEGKELGDPTEVALIAFSNKNNQDYNEIREKFIR
EGEIPFDSDRKLMSTLHTFNENKAMLTKGGPDVMFARCSYVFLDGEEKPMTEEILAKLKE
TNEEFSNQALRVLAYGYKRMPADTTELKLEDEQDIVLVGLTAMIDPPREAVYASIEESKK
AGIRTVMITGDHKTTAQAIGRDIGLMDADDIALTGQELDAMPEEELDKKLEHIAVYARVS
PENKIRIVKAWQKKGKITAMTGDGVNDAPALKQADIGVAMGSGTDVAKDSAAMILTDDNF
VSIVDAVGVGRTVFDNIKKSIAYLFAGNLGAIIAILFALVLDWINPFTALQLLFINLVND
SLPAIALGMEKAEPDVMKRKPRDINEGIFAGGTMRAVISRGVLIGIAVIISQYIGMQISP
EMSVAMAFTTLILARTLQTFAARSNVQTAFGAGFFSNKYVIGAVLLCFVLYGITVLPGAR
EIFSIPASFGLHEWSIAAGLALAAVVMMEIIKVVQNKFFK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
ttggagatataccgcaaaagcgcggcagaaacatttacacaactagaagcgacagaaaaa
ggcttaacaactagtgaggtaacaaaacgacaagaaaaatacggttttaacgaactgaag
aataaaaagaaagatccactttggaaacttttccttgaaacatttaaagatccgatggtt
attgttttagtcatcgcggccttggtgcagttggttttaggcgaagtagtcgaatcgctt
attatctttttagtgctgattgtgaactcgataattagcgtagttcaaacgcgaaaagca
gaaagttcgcttgatgcgttacgagaaatgtctgcgccagttgccaaagttattcgtgat
ggttctaagcaaagtattcatgcgcgcgaacttgttccgggtgacgtcgttattttggat
gcaggtgatttcgtcccagcagacggccgtttgttcgaaagtggctccttgaaaatcgac
gaagggatgcttactggagaatcggaggcagtcgagaaatatatcgataccattccagat
gaagtaggacttggcgaccgtgtgaatatggttttcagcgggtccctcgttgtatatggt
cgcgggatgtttgttgtaacaggcacagcgagcgaaacggaaatcggtaaaattgccgga
ttacttgaaacggcagaagcaaaacaaacaccactacaaagaaaactagaatcattcagt
aaaaagctaggactcggtattttagcactctgtgtacttatttttgctgtcgaagctggt
cgcgtattactcggcgacaattcagcggatatggcaacagcgattttaaatgcctttatg
tttgccgtggccgtagctgtagcagccattccagaagcactttcttctattgtaacgatt
gtacttgcggtcggaacaaacaaaatggcaaagcagcacgcgattattagaaagctccca
gctgttgaaacactaggctccaccagcgttatttgtacagacaaaaccggaacattaaca
caaaataaaatgactgtagtcgattattatttacccgatggaacaaaagaaaatttccca
gaaagtccagaaaattggtcagaaggggaacgtcgtttgattcatattgcggtactttgt
aacgattcaaatattaacagtgagggcaaggagttaggcgacccgaccgaagtggcgcta
attgcctttagtaataaaaataatcaagattacaatgaaattcgagaaaaattcatccgt
gaaggcgaaattccctttgattcagatcgtaagttaatgtctacgcttcatacctttaat
gaaaacaaggcaatgctaacaaaaggtggaccagacgtgatgttcgcgcgttgcagttat
gttttccttgatggggaagaaaagccaatgacagaagaaattttagcgaaactaaaagaa
acaaacgaagaattttcgaatcaagccttacgtgtcctcgcatacggctacaaacggatg
cctgctgatacaaccgaattaaaattagaagatgagcaagatatcgttctagttggttta
acagcaatgattgacccaccacgtgaagccgtgtatgcatccattgaagagtccaaaaaa
gcgggtattcgcacggttatgattactggtgaccataaaacaacggcacaagcaatcggc
cgggacattggtttaatggatgctgatgatatcgcattaacaggtcaagaactagacgca
atgccagaagaagaactcgacaaaaaactagaacatatcgcagtctacgcccgagtttca
ccagaaaacaaaatccgtatcgtcaaagcttggcagaaaaaaggcaaaatcaccgcaatg
actggtgatggtgtcaatgatgcgccagctctaaaacaagccgatattggtgtcgcaatg
ggtagcggaacagacgttgcgaaagactccgctgcaatgattctaacagatgataatttc
gtttcgattgtggatgcagttggcgtaggtagaaccgtttttgacaatattaagaaatca
attgcttatctatttgcaggaaacctaggtgcgattattgcgattttattcgcgctagtg
ctggactggatcaacccgttcactgcattacaattactatttatcaacttagtcaatgac
tccttaccagcaatcgcactaggtatggaaaaagcagaacctgacgtaatgaaacgcaaa
ccaagagatataaacgaaggtatttttgctggtggaacaatgcgcgccgttatcagtcgt
ggtgtattaatcggtatcgccgttatcatctcacaatacattggtatgcaaatttcacca
gagatgagtgttgcaatggcatttactacgcttatcctagcacgcacattacaaacattt
gcagctcgttcgaatgtccaaaccgcatttggcgcaggattcttcagcaacaaatacgta
atcggtgcagtattgctttgtttcgtcctatacggaattactgtactaccaggagctcgc
gaaatcttctcaatcccagcatcatttggcctacatgaatggtcgattgcagccgggcta
gcacttgcagcagttgtaatgatggagattattaaagtagttcagaataagtttttcaaa
taa

DBGET integrated database retrieval system