KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0875Help
Entry
LM5923_0875       CDS       T01164                                 

Definition
(GenBank) peptidoglycan binding protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Big_3 DUF5011 SdrD_B Amelogenin DUF4573
Motif
Other DBs
NCBI-ProteinID: ADB70719
Position
878388..884540
Genome map
AA seq 2050 aa AA seqDB search
MIKATRARHYLMLLMAFFLVLGQLNLTALNVFAKENGNDELTYEVQSKLTEDKKSADLTI
KVTPKSDQVKILTIETPDGEKREGQEVSYKAEKNGTTNFLINYQNTSEEKAETKTYTASY
EVSDIVSEDGVNKDSDTEKATEKEDANIQPPSTTNNTKNIKSLKSGQTTVELKIPDYDQT
AWANGDIKEVTATVNFGDSTSTGKKVNFTLPDGMRFVSLPVPSNYQAGTNEDTGVLSYLG
ASDPLGIAITSVEVPNKETAYSQATFGTVSYELSPGTEKASFKFSVRVDAAKYYGPTDLA
DPIKTEVYKGEASTPVASADQAIRAEGNKVVGYADQNHVKTMFRTWYNDQRLSEVLASTD
TTDSYNYTKSYSVVNGSNSLDSRGAAVYIAKNIEVTLYYPEGMEFVNVVNNAGTVLKENS
NVTITNYPSENKVVINNKHLNNSATSNSIYGVKYKVPKGTPAGTYSTAKAPHAVITTYDG
EVFESDALTTNPNDLTTIAPLDTCKVVDTTENKMTLTTANGQLNPNNETWAGSIQINNKK
SAGVKKNQMYQIKFDPNWEAYMVNIPFDSTISGNKISEVQYKTNLNDAFRTFDGALIKNN
NQMYRLDAKAVGLEEGEYFTEVKANVGDFAPGYQSTEASATYRWNSTASYGKIKPGVTSV
QYEGAIWDADDESNTKVSGISTYKVSSAESTVANGTAAFYNKAGTKVKTASAGETINTKA
TLVLHDYPYGTRTVLNDPEVYLHALEGTTIQPSSIKLTDQGGKDVNFTVEQETANNGDKV
YALKTTDVSVGVYVGYPTKHKYLNISYDTTFDVTLNKSINMDAQQVIAWGANVTPATGTN
TFSDLGLDVNKNGRDNDKLLSVNSSTLSIPKQDTVTVETFLSVAGEGDKAAYMEGEDSTV
SYFSPGTDADYTVKITNTSSGNASTFELYIPIPKTGQDFGSKFQSEPFKWDMKLNGALPV
SAEQQDQFDVSYATTATGDNYDSTDIYSNTVADYEKVNMVRIKVKTQINAGETQTFKVPL
KVDETFDSATEGNKIGERDIYNPYYRVITNTFAGSLSGTKVGAELVIGEVAGMLFNDKDV
NGSYEKDKGDEPLANETVELYKWNVSTSEYEPAKVGDKNITATTDSNGKYSFDYSDGVGY
GNYAVKFPDKAGYQYTLKNIGKDTSLNSDVPYSGADRGWAKQINPTLPSSQYTNAGYYAY
NPTQDLKVNLDEKQVQMGRSLEITLPKVASTTGQAAEDTIEPSFFKNIKATTNGYKWTVA
DTKVATVQTLADGSAAVVGVSTNNKTIDVTDLTITIQDIFGTEKSSKAPVYVTGTDGTVA
QQDGYTMGATDFSLEYKEATDLTKAQALTLAKTAAFEEVKDGVNSSAEDRLDQVQVNQTQ
LDAIKNGSNQGGVYPLTYTITKDSKTVSVTIQVTVAKDLTAVNAHDSTIYLGDTWDAEDN
FDSAANKEGDTNVAFSDVTVTGSVNTAVAGSYPVTYTYNGVSKKINVTVKDKLTAVNAHD
STIYTGDTWNAGDNFDSALDKDGNSVAFADITVTGTVNTNQAGTNTITYSYDGVSKTITV
TVLENKEGISAHDSTIYVGDAWNAKDNFDSAFDKDGNAVDLEDVTVTEKPTVDTTKAGAY
EVTYKYGKVSKKITLTVKAKLTAVNAHDSAIYIGDTWSAEDNFDSALDKDGNSVAFADIE
VKGTVDTDKVGTYPVTYTYDGVSKTINIQVKDILTAVNAHDSEIYIGDNWNAKDNFDSAK
DKDGNTVNWKDINVSENPAVDLETVGVYQVTYSYGGVSKTINLTVHPRKTSLEVHDSTMY
TGDKWKAEDNFDNATDKKGDQIPFKDVTVTGQVDSKTAGTYEITYIYDGLKKVARITVIQ
NQAQITVKDSVIPYGGKWEAEANFIGATNRDGVAIPFSKIKVDGTVDVNKAGTYKVIYTY
DPNEGTVDAGKKQLSVTANIQVEAEIVKPIKPIKPIKPIKPIKPIKPVDPSKPIDPKKPV
KSSNPTKPSTEKTPLKVVDNKQHTRTYEEAKPLPKTGDQTNTWVIWTGVCLLSMSLLLWV
VMRGRKKNYQ
NT seq 6153 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagcaactagagcgcgacattatttaatgctgttaatggcatttttcctagta
ttaggacaattaaatttaacagcccttaatgtgtttgcaaaagaaaatgggaatgacgaa
ctaacttatgaagttcagtctaaattgacagaagataaaaaatcagctgatttaaccatt
aaagtaacaccaaaaagcgatcaggtgaaaatcttgactattgaaacacctgatggagag
aagagagagggccaagaagtaagctataaagccgaaaaaaatggcacaactaacttttta
attaattatcaaaatacaagcgaagaaaaagcagaaactaaaacatatactgcttcttat
gaagtatctgacatagtttctgaagatggagtaaataaagattctgacacagagaaggca
actgaaaaagaagatgctaatattcagcctccttctactacaaataatactaaaaatata
aaatcacttaaatctggacaaacaacagttgaactaaaaataccagattatgaccaaaca
gcatgggcaaatggtgatattaaagaagtaacagcgacagtgaactttggcgacagtact
tctactggcaaaaaagtgaatttcactttaccagatggaatgcgttttgtttctttgcca
gtaccgagtaattatcaggctggtacgaatgaagatacaggcgttttgagttatttagga
gcaagtgatccactaggaatagccattacttcggtggaagtacctaataaagaaacagca
tatagtcaagctacgtttggaacagtaagttatgagctaagtccaggaactgaaaaagcg
agctttaaattttcagtacgggtagatgcagcaaaatattacggaccaactgacttagca
gatccaattaaaacagaagtatataaaggagaggcaagtacacctgttgcttctgcagat
caagcaattcgtgcggaaggaaataaagttgtagggtatgccgatcaaaatcatgtgaaa
actatgtttcgaacttggtataatgatcaaagactatcagaagtccttgcaagtacagat
actaccgactcttataactatacaaaatcatactctgtcgtgaatggatcgaatagttta
gacagtcgtggagcagcagtatacattgctaaaaatatcgaagtaacactttattacccg
gaaggaatggagtttgtaaatgttgtaaataatgctggcacagtgctgaaggaaaattct
aacgtaactattactaattatccaagtgaaaataaagttgtcattaataataagcactta
aacaacagcgccactagtaattctatttatggagtcaaatataaagtacctaaaggaact
cctgcaggaacatacagcacagcaaaagctcctcatgcagttatcacaacatatgatgga
gaagtatttgaatcagatgcactgacaactaatcctaacgatttaactactatagcacct
ctagacacttgtaaagttgttgatactaccgaaaataaaatgactttgactacagcaaat
ggtcaacttaatccaaataacgaaacttgggctggtagcattcaaataaataataaaaaa
agtgctggtgtgaaaaaaaatcaaatgtatcaaattaaatttgaccctaactgggaagct
tatatggtcaatatcccttttgatagcactatttcaggaaacaaaatcagtgaagtacag
tataaaacaaatttaaacgacgcttttcgaacatttgatggagcgcttattaaaaataat
aaccaaatgtatcgactagatgcaaaagcagttgggcttgaagaaggggaatatttcaca
gaagtaaaagcaaatgtgggagattttgcgcctggatatcagagcacagaagcttcggct
acttatcgttggaactctactgcttcatacggtaaaatcaagccaggcgttacatctgtc
caatatgaaggcgcaatatgggacgcggatgatgagtccaatacgaaagtatctggcata
tcaacctataaagtttcaagtgcagaaagtacagtagcaaatggtacagcagctttctat
aataaagctggtacaaaggtgaaaacagctagcgcaggagaaacaattaacacaaaagcg
acattagtgttacatgattacccttatggaacaagaacggtcctcaatgatccagaagtt
tatttacatgctctagaaggtacaacaattcaaccttcttccattaaactaacggatcaa
ggtggaaaagatgttaatttcacagttgaacaagaaacggcaaataatggagataaagta
tacgccttaaaaacaacggatgtgtcagtgggagtatatgttggctatccaactaaacat
aaatatctaaatatcagttacgatacaacgtttgatgtaactctaaataaaagtattaat
atggatgcgcaacaggtcattgcatggggagcaaatgttactccggcaacgggaactaat
actttttcggatttagggctagatgtaaataaaaatggcagagacaatgataaattactt
tctgtcaacagtagtactttaagtattccaaaacaagacacagttactgtagaaaccttc
ttaagcgtggctggagaaggcgataaagcagcttatatggaaggagaagacagtacagtt
tcctacttctcaccaggaacagatgctgattatacagtcaagattacgaacacttctagt
gggaacgcaagtacatttgagctttatatcccaattccaaaaactggtcaagacttcgga
tctaaattccaaagcgagccgttcaagtgggatatgaaactaaatggagcgctacctgtt
agtgcagaacaacaagaccaattcgatgtaagttacgcaacaaccgcaacaggagacaat
tatgattccaccgacatatactcaaatactgttgctgattatgaaaaagtaaatatggtt
cgaatcaaagttaaaacacaaattaatgcaggcgaaacacaaaccttcaaagtgccactt
aaagtagatgaaacatttgattcagcaacagaaggcaacaaaattggtgaacgtgatatt
tacaacccatattaccgtgtaattactaatacgttcgctggttcattatctggaacaaaa
gttggtgctgaactagtaattggtgaagtagcaggtatgctatttaatgataaagatgtt
aacggttcgtatgaaaaagataaaggcgatgaaccattagcgaatgaaacagttgagtta
tacaaatggaatgtatccacatctgaatatgaacccgccaaagtaggcgacaaaaatata
actgccacaacagatagcaatggtaaatacagttttgattatagtgatggtgttggttat
ggtaattatgcagtgaaattcccagacaaagctggctaccaatatacattaaaaaatatt
ggtaaagatacttctctaaatagtgatgtaccttacagcggagcagatagaggttgggcg
aaacaaatcaatccaactttaccaagctcacaatatacaaatgcaggttattatgcttat
aatccgacgcaagatttaaaagttaacctagatgaaaaacaagttcaaatgggtcgtagt
ttagaaatcactttaccaaaagtagcctcaacgactggacaagctgccgaagataccatt
gaaccaagcttctttaaaaatattaaagcaacaacaaatggctacaaatggactgttgca
gatacaaaagtggcaacagtacaaacgctagcagatggttcagcagctgtagtcggcgtt
tccacaaataataaaacaattgatgtaacagatttaacgattaccatccaagatattttt
ggaacagaaaaaagttccaaagctccagtatatgttactggaacagatggaacggttgcg
caacaagacggttacaccatgggtgcgactgacttttcattggaatataaagaagccact
gatttaacgaaagcacaggcactaactcttgcgaaaacagccgcttttgaagaagtaaaa
gacggcgttaattcaagcgcagaagatcgtttagaccaagttcaagtaaaccaaacacaa
ttagacgccataaaaaatggttctaatcaaggtggcgtgtatccattaacttacacgata
acaaaagatagcaaaacggtttcagttactattcaagtaactgtagcaaaagatttaacc
gcagtgaacgcacatgattctactatttatttaggagacacatgggatgcggaggacaac
tttgatagtgcagcaaataaagaaggcgacactaatgtagcgtttagcgatgtaacagtt
acaggaagcgtgaataccgcagtagctggttcgtatccagtaacttacacatataatggt
gtctctaaaaaaattaatgttactgtcaaagataaattaacagcagttaacgcacatgat
tccacaatctatacaggtgacacatggaatgcgggagacaactttgatagtgcgctagat
aaagatggtaattctgtcgcttttgctgatattacagtgacaggaactgttaatacaaat
caagctggtactaataccatcacttatagctatgatggagtttcgaaaactattacagtt
accgtcttagaaaataaggaaggtatcagtgctcatgactctactatttatgtaggagat
gcatggaatgccaaagataacttcgatagtgcttttgataaagatggaaacgcggttgac
ctagaagacgtaacagtcacagaaaaaccaactgtagatacgacaaaagcaggtgcttac
gaagtcacttacaagtatggaaaagtatcgaaaaaaatcactttaacagtgaaagctaaa
ttaacagcagtcaacgcacatgattccgcgatttacatcggagatacgtggagtgcagaa
gataactttgacagtgcgctggataaagatggcaattccgtcgcttttgctgatatcgaa
gttaaaggaaccgttgatacagacaaagttggaacatatccagtcacgtacacatatgac
ggtgtctcaaaaacaattaatatccaagtaaaagacatcttaacagcagtgaacgcgcat
gattctgaaatttatataggggacaactggaatgccaaagataattttgacagtgccaaa
gataaagacggaaatacagtaaattggaaagacatcaatgtttcggaaaatccagcagtt
gatttagaaacagttggtgtttaccaagtgacttatagttatggcggtgtttcgaagaca
attaatctgactgtccatccaagaaaaacaagtttagaagttcatgactccacaatgtat
acaggagataaatggaaagcagaagacaactttgataatgctacagataaaaaaggtgac
caaattcctttcaaagatgtcactgtaaccggacaagttgattctaaaacagcaggcacg
tatgaaataacctatatctatgatggattgaaaaaagtagcacgaattactgtaatccaa
aatcaagcacaaatcactgtaaaagatagcgtcattccatatggcggaaaatgggaagca
gaagctaactttataggtgcgacaaaccgagatggtgtagcaattcctttctccaaaatt
aaggtagatggtacagtagatgtaaataaagctggtacgtacaaagtgatttacacgtat
gatccaaatgaaggaacagtagatgcaggtaagaaacaactttctgtcacagcaaatatt
caagtagaagcagaaattgtaaaacctataaaacctataaaacctataaaacctataaaa
cctataaaacctataaaaccagttgatccatcaaaaccaatagatcctaaaaaaccagta
aaatcatcaaatccaacaaaaccatcaacagaaaaaacaccattaaaagtagttgataac
aagcaacatacaagaacatatgaagaagcaaaaccattaccaaaaacaggtgaccaaaca
aatacttgggtaatatggacaggcgtatgcttgctaagtatgagcttgcttctatgggtg
gtaatgagaggaagaaagaaaaactatcagtaa

DBGET integrated database retrieval system