KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0876Help
Entry
LM5923_0876       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1294 CPP1-like HIG_1_N
Motif
Other DBs
NCBI-ProteinID: ADB70720
Position
complement(884677..884934)
Genome map
AA seq 85 aa AA seqDB search
MILTIYLIAITLISFLLFAIDKRKAIKHAYRIPESVLLFSAFLGGAFGSWMSMQLFHHKT
QKPKFRILVPLAMVWTVGVVVWWLY
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgattttaacaatatatttaatcgcgataacgcttatttcttttctattattcgctatt
gataaacggaaagcaattaaacatgcttaccggatacctgaatctgtgctacttttctct
gcatttcttggtggggcgtttggtagttggatgtcgatgcagttgtttcaccataaaaca
caaaaaccgaagttccggattttagtgccgcttgcgatggtttggactgttggagttgtg
gtttggtggttgtactga

DBGET integrated database retrieval system