KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0877Help
Entry
LM5923_0877       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K09022  2-iminobutanoate/2-iminopropanoate deaminase [EC:3.5.99.10]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LM5923_0877
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.10  2-iminobutanoate/2-iminopropanoate deaminase
     LM5923_0877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_L-PSP
Motif
Other DBs
NCBI-ProteinID: ADB70721
Position
885013..885390
Genome map
AA seq 125 aa AA seqDB search
MAKEIIQTSSAPKALGPYSQAVKVNGLIFTSGQLGINPATGELVVGATKQAEQAFKNLAA
VLEEAGSGLDKIIKATVFFKDLNEFKAVNEVYATFFSSDFPARSAFQVAKLPLDAEIEIE
VIAEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaattattcaaacatcgtcagcaccaaaagcacttggaccatactcgcaa
gctgtaaaagtgaatggacttatttttacatcaggtcaacttggtattaacccggctacc
ggcgaattagtagtaggcgcgacaaaacaagccgaacaagcatttaaaaatttagcagca
gtattagaagaagctggttctggactggacaaaattattaaagcaactgttttcttcaaa
gatttaaatgaatttaaggctgtgaatgaagtttacgccacgttcttttccagtgatttt
cctgcgagaagtgctttccaagtagcgaaattaccgctagatgctgaaattgaaatcgaa
gttatcgcagaagcataa

DBGET integrated database retrieval system