KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0878Help
Entry
LM5923_0878       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2 Meth_synt_1
Motif
Other DBs
NCBI-ProteinID: ADB70722
Structure
PDB: 

Position
885647..886750
Genome map
AA seq 367 aa AA seqDB search
MNQVAPFYADHVGSILRTKGIKDAREKFQSGEITALELRKIENTEIKYIVEKQKEVGLKS
ITDGEFRRAWWHFDFLENLDGVEGYDAAGGIQFSKVQTKSHSVKITGPIDFTTHPFIEDF
IFLKEAVGDNHVAKQTIPSPAMLHYRGDIEYQPYLDDAEKFANDLATAYQKAIQAFYDAG
CRYLQLDDTSWSYLCSDEQREVVRQRGFDPETLQETYKNLINEAIKHKPADMVITMHICR
GNFRSTWIAEGGYGPVAETLFGKLNIDGFFLEYDNERSGDFAPLKYVTRPDLKIVLGLIT
SKTGELEDEAAIKARIEEASEIVPLSQLRLSPQCGFASTEEGNILTEEEQWDKLRYVVRL
ANDIWGE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagtagctccattttatgcagatcatgtgggaagtattttacgcacaaaggga
attaaagacgcacgagagaaattccaaagtggcgaaataacagccttagagttgcgcaaa
atcgaaaatacagaaattaagtatatcgtcgaaaagcaaaaagaagtcggcttaaaatca
atcacagatggcgagtttcgccgtgcttggtggcattttgacttcttggagaatttggat
ggggtagaaggatacgatgcggctggcggcattcaattcagcaaagtccaaacaaaatcg
cattcggtaaaaatcacaggaccaattgactttacgacacatccatttatagaagatttt
atttttctcaaagaggctgttggtgacaatcatgtcgcgaaacaaactattccaagtcca
gcgatgctccattatcgcggggatatagagtatcagccttatttagatgatgcagagaag
tttgccaatgatttagcgactgcgtatcaaaaagcgattcaagcattttatgatgccggt
tgtcgttacctgcaattagatgatacgtcttggagttatttatgctctgatgaacagcgt
gaagtcgtgcgccaaagaggttttgacccagaaactttacaagaaacatataaaaatctt
atcaacgaagcaataaaacataaaccagctgatatggttattacgatgcacatttgtcgt
gggaatttccgctccacatggattgctgaaggtggttatggtccagttgcagaaacgttg
tttggcaaactaaatatcgatggtttctttttggagtatgataatgaacgttctggagat
tttgcgccactaaaatatgttacccgtccagacttgaaaatcgttctaggcttaattaca
tccaaaacaggtgaattagaggacgaagcagccattaaagcacggattgaagaagcgagt
gaaattgtgcctctaagccagttgcgcttaagcccgcaatgcggtttcgcctcgacagaa
gaaggaaatattttgacggaagaagagcagtgggataaattgcgatatgttgtccggctt
gcgaatgatatctggggcgaataa

DBGET integrated database retrieval system