KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0879Help
Entry
LM5923_0879       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIY-YIG UVR T_Ag_DNA_bind
Motif
Other DBs
NCBI-ProteinID: ADB70723
Position
886855..887955
Genome map
AA seq 366 aa AA seqDB search
MDDKLQKKLTLLPESPGCYIYRDENNEILYIGKSKCLKNRVKSYFHSKQIGKTARLVRQI
RDLELIITTSEKEALLLEMILIQKYQPPFNIQLKEGTSYPYIKITNEKNPHIEVVFEVKR
DGAHYFGPYPGRFSARQTVDLIEKLFPLCRCDGKPGRPCLYYHLGLCLGPCQAEIEPAVY
KKQIHKISRFLEGDVKNVKDKLLGDMLTATENLEFERAAELRDKIHAINETIEKQHIIFP
GLKNRDIIGCYEQDNYLSVFVFFVRNGAINGSKWHVFQVEKTLQEELATFLNQFYEDPNN
IQPKELLIAEKIDKSLLNEPLRKACLFPQKGSKKKQVDLAIENAKSAYIAYAKMKEYDFE
IQLNNH
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttggacgataaattacaaaagaaattgaccttattacctgaatcaccaggttgttatatt
tatagagatgaaaataatgaaattctttatattggcaaatctaaatgtttgaaaaaccgc
gtaaagtcttatttccatagcaaacaaattggaaaaactgcaagactagtcagacaaatt
cgagatttagaattaattattacaacttccgaaaaagaagctttactactcgaaatgatt
ttaattcaaaaataccagccaccttttaatatccagttaaaagaagggacgagctaccca
tatatcaaaattacgaatgaaaaaaatccgcatatcgaagttgtatttgaagtaaaacga
gacggtgcgcattattttggtccttatccaggtcgtttttcagcaagacaaacggtggac
ctaattgaaaaattgtttccactttgtcgatgtgacggtaagccaggacgaccatgtttg
tactaccatcttggattgtgcctaggtccatgccaagccgaaattgagccggctgtttat
aaaaaacaaatccataaaattagtcggtttcttgaaggtgacgtgaaaaatgtgaaagat
aaactactgggggacatgttaactgcaaccgaaaatctcgaattcgaaagagctgcagaa
cttcgagataaaatacacgctattaatgagacaatcgaaaagcaacatattatttttcct
ggtctaaaaaatcgggatataattggttgctatgaacaagataattatttaagtgtcttc
gttttcttcgttcgaaatggtgcaattaatggaagtaaatggcacgttttccaagtcgaa
aaaacccttcaagaagagttagccacgtttctcaatcaattttatgaagatcctaacaac
attcaaccaaaagagttgttaatcgctgaaaaaatagataaaagcttgctgaatgagccg
cttagaaaagcttgtttatttccacaaaaaggcagtaaaaagaaacaagtagacctggct
atcgaaaatgctaaaagtgcttatattgcatacgcaaaaatgaaagaatatgattttgaa
atacaactaaacaatcattag

DBGET integrated database retrieval system