KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0881Help
Entry
LM5923_0881       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K02028  polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Module
lmy_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmy02000]
    LM5923_0881
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.21  polar-amino-acid-transporting ATPase
     LM5923_0881
Transporters [BR:lmy02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    LM5923_0881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 RsgA_GTPase AAA_22 AAA_16 AAA_23 AAA_13 AAA_24 AAA_33 AAA_10 AAA_30 SbcCD_C Septin MIT_C dNK AAA_18 Rad17 cobW PRK ATP_bind_1 NACHT T2SSE ATPase_2 MMR_HSR1 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: ADB70725
Position
889560..890288
Genome map
AA seq 242 aa AA seqDB search
MTKLKVTGLKKSFGANEVLKGIDIEVKEGEVVCVIGPSGSGKSTFLRCMNNLEEITAGEV
VVDDFNITDKKVDINKVRENIGMVFQHFNLFPHLSVLENITLAPVELKKMDKEAAKSNAL
RLLEQVGLREKAEEFPNQLSGGQKQRVAIARALAMDPDIMLFDEPTSALDPEMVGEVLGV
MKELAKGGMTMMIVTHEMGFAREVGDRVIFMDGGYIVEEGKPADIFDNPTNERTISFLDK
VL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacttaaagtaactggcttgaaaaagagttttggcgcaaatgaagtgttaaaa
ggcattgatatagaagtaaaagaaggcgaagtagtttgtgtaatcggaccttctggctca
ggtaaaagtacatttcttcgttgcatgaataacctagaagaaattacagcaggtgaagta
gttgttgatgattttaatattactgataaaaaagtagatattaataaagttcgcgaaaat
atcggcatggttttccaacattttaatcttttcccacatttgtctgttttggagaacatc
acattagctcccgttgaattgaaaaaaatggataaagaagccgcgaaaagtaatgccttg
cgtttattagaacaagtaggattacgagaaaaagcggaagaatttcctaatcaactttcc
ggtgggcaaaaacaacgggtggcgattgcgagagcacttgcaatggatcctgacattatg
ttgttcgatgagcctacatcagccctcgatccagagatggtgggtgaggttttaggcgtt
atgaaagaattagctaaaggcggcatgaccatgatgattgttacgcatgagatgggcttt
gctcgtgaagttggcgaccgagttatctttatggatggtggctatattgttgaagaaggc
aagccggctgatatttttgataacccaaccaatgaaagaacaattagcttcttagataaa
gtattataa

DBGET integrated database retrieval system