KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0882Help
Entry
LM5923_0882       CDS       T01164                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00330  Arginine and proline metabolism
lmy00360  Phenylalanine metabolism
lmy00380  Tryptophan metabolism
lmy00627  Aminobenzoate degradation
lmy00643  Styrene degradation
lmy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LM5923_0882
   00360 Phenylalanine metabolism
    LM5923_0882
   00380 Tryptophan metabolism
    LM5923_0882
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LM5923_0882
   00643 Styrene degradation
    LM5923_0882
Enzymes [BR:lmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     LM5923_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase S1FA
Motif
Other DBs
NCBI-ProteinID: ADB70726
Position
complement(890337..892187)
Genome map
AA seq 616 aa AA seqDB search
MKKRILITIIVVCTVFSIIGGYVFFTSQKNTTSENKSAVSKNKKPIVKKEKPKQSSNNLT
LGKNKEDFHLEKGFDNMQLQVERIIDRIFQSSLKNRTEIKVKPKNNPQKKQNIKPVKPIP
SKPEKPEDSPSPFYDKARVMAPINNQLATLDLTVLEAKEPLIIGADVTKLQQLIATKQLS
YKELAGIYLNRIKKYDQNGLNLNAITEINPTIIAEAEQLDKENTTNKSALYGMPVLLKDN
IGTKELPTSAGTVALKDWVIGKDATIVENLKANGALILGKTNMSEWAAGMDEDLPNGYSG
KKRQSKNPYSANLDPSGSSSGSATAATSDFAAIAIGTETNGSIITPASAQSAVGYKPSQG
LVNNKGIIPLSSRFDTPGPLTRTVNDAYLTANALTNTTSNPSLSTDALKGKRIGLLADGE
SNEETAVIKKIKLDLQKAGATIIEGIAVGEFEQKESYDYASLINTDFKHDLNQFLQVNHS
PMSTLESIIQFNQTNPTRNMKYGQAELVKAQQSTITKQQADNLASNLIQSSQNELDSVLQ
KDKLDAVVTIGMGGSVMFLAPIAGNPELTIPAGYDEESNQPISLTFITARNSDKILLNMG
YAYEQQSQNRKSPNLK
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgcattttaataacaattatcgtagtttgtacagtcttcagtatcatcggt
ggctacgtattctttactagccaaaaaaatactacatcagaaaataaaagtgccgtttct
aaaaataaaaaacccatcgtaaagaaagaaaaaccaaaacaatcatcaaacaatttaaca
cttggcaaaaataaagaggactttcatttagaaaagggcttcgacaatatgcaattacaa
gtagaacgtataattgaccgtatttttcaaagttcgctcaaaaatagaactgagattaaa
gtcaaaccgaaaaataacccacaaaaaaaacagaacattaaacctgtaaaaccaatacca
agtaaaccggaaaagccagaagattcacctagtcccttttatgataaagcgcgtgttatg
gcaccgattaataaccaattagctacgctagatttgactgttcttgaagcaaaagaacca
cttatcatcggtgctgatgttacaaaactccagcaacttattgcgacaaaacaacttagc
tacaaagaattagccggtatttatttaaaccgaataaaaaaatatgaccaaaatggccta
aatttaaatgcaataactgaaatcaatccaactattattgccgaagcagaacaactggat
aaagaaaacacaaccaacaaatctgctttatacggtatgccggtccttttaaaagataac
attggtacgaaagaacttcctacgagcgctgggaccgtagccttgaaagattgggtaatc
gggaaagatgctacaattgttgaaaatctaaaggcaaatggcgctttaatcctcggaaaa
actaatatgtccgagtgggcggctggaatggacgaagatcttccaaatggctattcaggt
aaaaaaagacaaagtaagaatccttactcagcgaatttagatccatctggttcaagttct
ggctctgccacagcagccacaagtgattttgcagcaattgcaatcggcacagaaacaaat
ggttctattattacgcctgcttctgctcaatcggctgttggatataagccatctcaaggt
ttagtaaataacaaaggcataattcctctatcaagcagatttgatacacctggaccgcta
acaagaaccgttaatgatgcctatttgacagcaaacgctttaacaaacactacttcaaat
ccatctctttctacggacgcccttaagggtaaacgtatcggtcttttggcagatggagag
agtaatgaagaaacagctgttataaagaaaataaaacttgatctgcaaaaagctggcgct
actatcattgaaggcattgcagtgggcgaatttgaacagaaagaatcttatgattatgcc
tcattaataaatactgactttaaacatgatttaaaccagtttttgcaagtgaaccattct
cctatgtcgactttggaatcgattattcaatttaatcaaacgaatcctacaagaaatatg
aaatacgggcaagccgaacttgtcaaagcacagcaaagcacaataacgaaacaacaagcg
gacaatttggcgagtaatttgattcagagctcacaaaacgaacttgactctgtgcttcaa
aaagacaaactggatgctgtcgtaacaattggtatgggaggttcggtgatgtttcttgcg
ccaattgcggggaatccggaactgactatcccagctggctatgatgaagaatcaaatcag
ccaattagcctgacttttattactgctagaaatagcgataaaatcttattaaatatgggt
tatgcctatgagcaacaatcgcaaaatagaaaaagtcctaacttaaagtaa

DBGET integrated database retrieval system