KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0883Help
Entry
LM5923_0883       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mhr1
Motif
Other DBs
NCBI-ProteinID: ADB70727
Position
892721..892900
Genome map
AA seq 59 aa AA seqDB search
MKTNFEDGVMRLDNNQKDLNQVIRQLKEKGIVVEKTKSRKDIWKSVSSKAMPNMTLRLQ
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaattttgaagatggagtgatgagattggataataatcaaaaagacttaaat
caagtaatccgtcagctcaaagaaaaaggaattgtcgttgaaaaaacaaagtcacgaaaa
gatatttggaaatcggttagtagtaaagcgatgccgaatatgacacttcgattgcagtaa

DBGET integrated database retrieval system