KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0885Help
Entry
LM5923_0885       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_Tnp_1_2 TetR_C_6 CaATP_NAI
Motif
Other DBs
NCBI-ProteinID: ADB70729
Structure
PDB: 

Position
893960..894514
Genome map
AA seq 184 aa AA seqDB search
MTKKLIKEVALTLFAEKGYDGTALSEIAKAVGIKTPSLYAHFASKEALFLEVYQDSIQME
LTELGRVAEREDLVGEEKLQSIFFVATDFSSNPDEKKFFQRAVFYPPKSLFQELKEETKT
YEQLTNRILRETLEKIVSEEALVRWMHVFYALLDGLSVEHGIYDETEFELRRKSAWAVLA
SLLK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaaactgattaaagaagtagcgttaaccctttttgcggaaaaaggctacgat
gggacggcgctttcggaaatcgcgaaagctgttgggattaagacaccatcgctatatgcc
cattttgcatcaaaagaggccctttttttggaagtttatcaagatagcatccagatggaa
ttaacagaactcggacgagtagcggagcgagaggatttagttggggaagagaagctacaa
tcaattttctttgtggcaacagatttttctagcaatcccgatgagaagaaatttttccag
cgcgccgtcttttatccacctaagtcactttttcaagaattaaaagaagaaacaaagaca
tatgaacaactgacgaatcgaatattgcgcgaaacgttagaaaaaatagtatccgaagaa
gcacttgtaagatggatgcacgttttttatgcacttcttgatggactgagtgtggaacac
ggcatttatgatgaaacggaatttgagttgcgaagaaaatctgcttgggcagttcttgca
agtttactcaaatga

DBGET integrated database retrieval system