KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0886Help
Entry
LM5923_0886       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K11741  quaternary ammonium compound-resistance protein SugE
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmy02000]
    LM5923_0886
Transporters [BR:lmy02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   LM5923_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Multi_Drug_Res
Motif
Other DBs
NCBI-ProteinID: ADB70730
Position
894531..894872
Genome map
AA seq 113 aa AA seqDB search
MAWFYLIMAGLSEIVWAFGLKESHGFTMLGWSLLTIAFLIVSFGLFSISMKSIPIGTAYA
VFTGIGAAGTAIIGMIFLSEGVSFWKIVSLIVLLTGIIGLKLVDGNESEKEAK
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
ttggcttggttttatttgattatggcagggttatcagaaattgtttgggcttttggatta
aaagaatcacatggtttcacgatgttaggttggagccttttgacgatagcatttttgatt
gttagttttggtttgttttcgatttccatgaagtcaattccgattgggacggcatatgcg
gtttttacaggaattggggctgcagggacagctattattgggatgattttcctttcagaa
ggtgtttctttttggaagattgtttcgcttatcgttttattgacagggattattggtctg
aaattagtggatggcaatgagtctgaaaaggaggctaaataa

DBGET integrated database retrieval system