KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0891Help
Entry
LM5923_0891       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K02529  LacI family transcriptional regulator
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lmy03000]
    LM5923_0891
Transcription factors [BR:lmy03000]
 Prokaryotic Type
  Helix-turn-helix
   LacI family
    LM5923_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 MarR_2 HTH_10 HTH_Crp_2 Phage_CI_repr DUF3842 HTH_24 TetR_N Fe_dep_repress Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: ADB70735
Position
complement(898686..899711)
Genome map
AA seq 341 aa AA seqDB search
MKKVTMQDIADRLNITKNSVSQALGNKNGVSEQTKLAVFKMADELGYKYKREIAREVVKE
KFALLATSFALSQRSFFGEIIDNMKQSIIAHQAELIIFPVTDEEAATNQLPEQLTSENWT
GIFLLSHINTDYSKKVIDLGMPVVLIDHHDPHLKADAVISQNKDGAFMAVEFLIQNKHQK
IGFLGDVTFSPSYEERLEGYKKALQYYHIPFNKKYAITRIKEEQTTLYRTLDELDELPTA
WFCVNSGLGFILNTYLQSKGYNIPKDLSIICFDNTEFTVLSNPQLTTMCTNLSFMGEKAV
ELMYNRIRKPDEGFVHLALATNLIARDSVGENKKTDSASES
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagttacgatgcaggatattgctgacaggctaaatataaccaaaaattcagtc
tcgcaagctttaggcaataaaaatggggttagcgaacaaactaaactagctgtttttaaa
atggcagatgaattaggttataaatataaaagagaaatcgcacgtgaggttgtcaaagaa
aaatttgcgcttttagcaacttctttcgccctttcgcagcgcagtttttttggtgaaatt
atcgataatatgaaacaaagcattatcgcccaccaggccgaacttatcatttttccagtt
acggatgaggaagcggcaacaaatcaattgccggagcagcttacaagtgagaactggact
ggtattttcttgctgtcgcatattaacaccgattatagtaaaaaagtgatcgacctcggc
atgccagtagtgctgatagatcatcatgatccgcatttaaaagccgatgcagttattagt
caaaacaaagacggtgcttttatggctgtggaatttttaattcaaaataagcaccaaaaa
atcggttttcttggtgatgtaactttttctccaagttatgaagaacgactagaaggatac
aaaaaagctttgcagtactatcacattccttttaacaaaaaatatgctatcactcgcatc
aaagaagaacaaactacattgtatagaactttagacgaactagacgaactccctactgct
tggttttgcgtcaactcaggtcttggatttattctcaacacttacttacaatcgaaaggc
tataatattccgaaagacttatctattatttgctttgataataccgagtttactgtacta
agtaatccgcagctgacaacgatgtgtactaaccttagttttatgggcgagaaagctgtc
gaacttatgtataatcgcataagaaaaccagatgaaggttttgttcatctggcgcttgca
actaatttaatagcccgagattctgttggcgaaaataaaaaaaccgattcagcgagcgag
agctga

DBGET integrated database retrieval system