KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0893Help
Entry
LM5923_0893       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K02025  multiple sugar transport system permease protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Module
lmy_M00207  Putative multiple sugar transport system
Brite
Transporters [BR:lmy02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative multiple sugar transporter [MD:M00207]
    LM5923_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 PaRep2a
Motif
Other DBs
NCBI-ProteinID: ADB70737
Position
901272..902150
Genome map
AA seq 292 aa AA seqDB search
MKRRNNKLGWSFTSPYLIFTAIFFLVPLVWSIWLSVTDWNMMSPEINFVGFDNFIKAFTS
PAVQAAFFVTYKFLIVFVPMALIISMIVAVLVNGLPKFKGLYLVAFFLPYLSSGVVTSLI
VQGLLSYNSALNVFLRGHFGWDIDWLGTPMSALVIISLMIAWKMSGYYALILISGLASIN
HEIYEAAAMDGSGRFRTFWKVTVPMLYPALFTVIVLAVGVSFGIFTEVYQLTGGGPNFAT
NTWQMEIFNQAFVNLNSGYASAISLMAATVTFASIGVIKKMLEKWGQRNGWT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcgaaataacaaattgggctggtcatttaccagcccgtatctcatattcaca
gcgatatttttcttagtaccgcttgtttggtcaatttggttatctgtgactgattggaac
atgatgagtccggaaatcaattttgttggctttgataattttattaaagcgttcactagt
ccagcagttcaagcagccttttttgttacttataaatttttgattgtttttgttcctatg
gcgttaattatttcgatgattgtcgcggtattagtgaatggactaccgaagtttaaagga
ctttatttggttgcgtttttcctaccgtatttgtcttcaggagttgtaacttcgctaatt
gtacaagggttgctttcatacaatagtgcgctgaatgtgtttttacgcgggcattttggt
tgggatatcgattggctcggaacaccaatgtcggcgctcgttattatttcactaatgata
gcttggaaaatgtctggttattatgcgctcattttaatttctggacttgctagtattaat
catgaaatttatgaagctgcagcaatggatggttctggtagatttagaacattttggaaa
gtcactgttccgatgctatatccagctttatttactgtgattgttttagcggtgggtgtt
agctttggtattttcaccgaagtttaccaattgactggtggtggaccgaattttgcaaca
aatacatggcaaatggaaatttttaaccaagcatttgttaacttgaattctggttatgct
tcagcgatttctctaatggctgctactgtaacgtttgcatcaattggtgttattaagaaa
atgcttgagaaatggggtcaaagaaatggttggacataa

DBGET integrated database retrieval system