KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0896Help
Entry
LM5923_0896       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1861
Motif
Other DBs
NCBI-ProteinID: ADB70740
Position
904520..905434
Genome map
AA seq 304 aa AA seqDB search
MNTIENLLQVYRENSAAFGTRITLNGAGDKDVYNITAPFHWLGQEYIAGRVESRDSEFSE
VRFFEKTETDKYQLVENTTVLALQDPFVTFVQGELIIGGVEVFPKETDPTMLDWRTNLYR
ATSLTDFEQILAGPIGMKDLRIKELADGRILVLTRPQGEKGGRGKIGAVVMESLTELTIE
KIEAAPLLKRNFSGDEWGGGNEIHLLEDERIGVLGHIACFDEAGDRHYYACSFRLNEDFS
QIEQEKIIAERANFAPSEPKRPDLADVVFSGGLIRNSDGTATLYAGIGDSDAQKLAIPDP
FKNN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaatcgaaaatttgttgcaagtttaccgggaaaatagtgctgcgtttgggaca
cgtatcacgttaaatggtgctggcgacaaagatgtatacaatattacggcaccatttcat
tggctaggacaagaatatattgcaggtcgagtggagtcgcgtgatagcgagttttcggaa
gtacgcttttttgaaaaaacagagacggacaaatatcaattggttgaaaatacgactgtt
ttagcgctacaagatccatttgttacatttgttcagggtgagctgattattggcggggta
gaagttttcccgaaagaaacggacccgactatgttagattggcgtactaatttatatcgg
gcaacctcgcttactgattttgagcaaattcttgccggaccaattgggatgaaagatttg
cgcatcaaagaattagcagacggacgcattttagtattaacaagacctcaaggtgaaaag
ggcggtcgcgggaaaatcggcgcagtcgttatggagtcactaacagaattaactatagag
aaaatagaagctgcgccacttttaaaacgtaatttttcaggagatgaatggggtggcgga
aatgagattcatttgttagaagatgagagaattggcgtgcttggtcatatcgcttgtttt
gatgaagcgggcgatcgtcattattacgcctgttcttttcgattgaatgaagatttttcg
caaattgagcaagaaaaaataatagctgaacgtgccaattttgcacctagtgagccgaaa
agacctgatttagcagacgttgtatttagcggtggtttaatcaggaattcggacgggact
gcgacactttatgcagggattggcgattctgatgcacaaaaattagcaattcctgatcca
tttaaaaataactaa

DBGET integrated database retrieval system