KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0902Help
Entry
LM5923_0902       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mga HTH_7 TetR_N HTH_Tnp_1_2 DUF1492 HTH_AraC HTH_29
Motif
Other DBs
NCBI-ProteinID: ADB70746
Position
complement(911182..911739)
Genome map
AA seq 185 aa AA seqDB search
MNNYIKVHQPLNVDLRTQKTQTKLYTVLERFYLEGRTFESISIKDLCEQAQISRATFYRH
HEEIIQIIEVQILRTMQYFSLEFDQIILTKENIQRLILRSIQKNPLLFQAIFWSRAENIF
LDVVSGEILRISLLKEISFSDSNFIPNCFARMILSLAAEIQQSNKDYTNGQLVELIQEAA
RFLQK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaataactatataaaagttcatcaaccgttgaatgttgatctacgtacacaaaaaaca
caaaccaaactatatacggttttggagaggttttatctggaaggtagaacttttgaatca
atatcaataaaagatttatgtgaacaagcccaaatatcacgagccactttttaccgtcat
catgaagagattattcaaattattgaagtccagattttacgaaccatgcaatacttctct
ttggaattcgaccaaattattttaacaaaagaaaatatccaacgcttaatcctccgctcc
atccaaaaaaacccgcttttatttcaagcaattttttggagccgcgctgaaaatattttt
ttagatgtggtatctggagaaatacttcgaattagtttgttaaaagaaatttccttttca
gatagtaactttattcctaattgttttgctagaatgattttaagtttagcggcagaaatt
cagcaatcgaataaagactatacgaatggtcaattagttgaattgatacaggaggcagct
cgctttttacaaaaataa

DBGET integrated database retrieval system