KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0905Help
Entry
LM5923_0905       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_5
Motif
Other DBs
NCBI-ProteinID: ADB70749
Position
complement(913200..913553)
Genome map
AA seq 117 aa AA seqDB search
MTKVYNIGVEATLEVIGGKWKPVILCHLREGKKRTGELKRLIPNITQKMLTQQLRELEKS
GVIIRKVYEQIPPKVEYSLSEYGESLSEILNKLCLWGENHVDLLLTKNEDIVLLKRD
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagtatataatatcggcgtcgaagctacactagaagttattggcggcaaatgg
aaaccagtcatcctttgccatttacgcgaaggcaaaaaacgaactggcgaattaaaacga
ctcatccccaacatcacacaaaaaatgctcacacaacaattgcgcgagctcgaaaaatcc
ggcgttattatccgtaaagtttacgagcaaattccaccaaaagtggagtattctttgagc
gaatacggcgaatcgttgtcggagattttgaacaaactttgcttatggggcgagaatcat
gtagatttattgctgacgaagaatgaggatattgttttgttgaaacgagattaa

DBGET integrated database retrieval system