KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0908Help
Entry
LM5923_0908       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
  KO
K02759  PTS system, cellobiose-specific IIA component [EC:2.7.1.196 2.7.1.205]
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
Pathway
lmy00500  Starch and sucrose metabolism
lmy02060  Phosphotransferase system (PTS)
Module
lmy_M00275  PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:lmy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LM5923_0908
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    LM5923_0908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lmy02000]
    LM5923_0908
Enzymes [BR:lmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.196  protein-Npi-phosphohistidine---N,N'-diacetylchitobiose phosphotransferase
     LM5923_0908
    2.7.1.205  protein-Npi-phosphohistidine---cellobiose phosphotransferase
     LM5923_0908
Transporters [BR:lmy02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    LM5923_0908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIA MitMem_reg Meis_PKNOX_N FUSC
Motif
Other DBs
NCBI-ProteinID: ADB70752
Position
917088..917417
Genome map
AA seq 109 aa AA seqDB search
MDIEKISFSLISLAGDSFSKLIEALQAAKESDSELVEQLLKEADDLMIEAHKVQTEMLIQ
ETRGEQANFSVLLVHAQDTLMNTILASTLIREMIEMHQEIKTLRKEEEK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggacatagaaaaaatatcgttttcattaatttcactggcgggggattcgttttctaaa
ttaattgaagcactacaggctgcaaaagaatcagattcagaactagttgaacaactttta
aaagaagcagatgacttaatgattgaagcacacaaggtacaaacggaaatgctgattcaa
gaaacaagaggggaacaagcaaatttttccgtcttactcgtgcatgcgcaagatactcta
atgaataccatcttagcatcaactttaattcgcgaaatgattgaaatgcatcaagagatt
aaaacattaagaaaagaggaggaaaagtaa

DBGET integrated database retrieval system