KEGG   Listeria monocytogenes 08-5923 (serotype 1/2a): LM5923_0911Help
Entry
LM5923_0911       CDS       T01164                                 

Definition
(GenBank) hypothetical protein
Organism
lmy  Listeria monocytogenes 08-5923 (serotype 1/2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: ADB70755
Position
919119..919847
Genome map
AA seq 242 aa AA seqDB search
MKLIINENEQLVAETVSRRIIELVKEKPASLICIAGGDTPLLTIEALIKANQAGEVDFSN
TQFVGLDEWVGLGRETKGSCIQTLYDAFFDRLKNVSSEQICFFDGKATSLTDECARVDKF
IDDRGGMDFILLGIGLNGHIGFNEPFVPVDVNCHVVELDDVTKRVMSKYFDTDLPLTHGI
SLGMQQILAAKEIFLVATGEKKIDIVKQVVEKEPTVAIPATLVKDSNTTLVVDKIAASGV
EA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaattattaacgaaaatgaacaactcgtggcggaaacagtgagccgaagaatc
attgaattggtaaaagaaaaaccagcaagcttaatttgtatcgctggtggagatacacct
ttattaaccatagaagcacttattaaagcaaatcaagcgggcgaagtagactttagtaac
acgcaatttgttggtttggatgaatgggttggccttggacgcgaaacaaaaggtagctgt
atccaaacactctatgatgcatttttcgaccgtttgaaaaatgtttctagtgaacaaatt
tgctttttcgatgggaaagcaacaagtttaacggatgaatgcgctcgtgtagacaagttt
atcgacgatcgtggcggaatggattttattttgctggggattggactaaatgggcatatt
ggcttcaacgagccatttgtgccagtagatgtgaattgccatgtcgtggagctggacgat
gtaacgaaacgtgtcatgagtaaatattttgatacagatttgccactaacacacggaatt
tctcttggtatgcaacaaattttagcggctaaagaaatatttttagtagcaactggcgag
aaaaaaatcgatatcgtgaaacaagtagtggaaaaagaaccgacagtagcgattcctgca
actctcgtaaaagattcaaatacaacgcttgtagtcgataaaattgccgcgagtggggtg
gaagcataa

DBGET integrated database retrieval system